Sunday, November 30, 2008

BIRTHDAYS: Britney Spears (Birthday 2nd December), Famous American Singer, Biography of Britney Spears on Career, Personal Life, Awards & Achievements

Jamie Spears— Britney Spears Father
Lynn Spears— Britney Spears Mother
Bryan Spears— Britney Spears Brother
Jamie Lynn Spears— Britney Spears sister
Jason Allen Alexander— Britney Spears 1st husband
Kevin Federline— Britney Spears 2nd husband
Sean Preston Federline— Britney Spears Son
Jayden James Federline-- Britney Spears Son

Britney Jean Spears an American entertainer and recording artist was born on 2nd December, 1981 in McComb, Mississippi. Britney Spears raised in Kentwood, Louisiana. Britney Spears first emerged on National TV in 1992 as a competitor on the Star Search program and also went on to the star on TV series The New Mickey Mouse Club from 1993-94. And after a concise membership with pop melodic band Innocence. After releasing Britney Spears debut album ...Baby One More Time in 1999, Britney Spears signed the recording contract with the Jive Records.

Biography of Britney Spears

Britney Spears Early Life

In her early days, Britney Spears displayed her talent. Britney Spears appeared on Star Search television show. At the age of 8, Britney Spears gave an audition for New Mickey Mouse Club. Britney Spears attended the Professional Performing Arts School in New York City. And after it, Britney Spears worked in TV commercials and performed in Off-Broadway plays. Then Britney Spears auditioned and after it Britney Spears was selected for the New Mickey Mouse Club TV show. Spears acted as an associate of cast throughout 1993-94 seasons.

Britney Spears Career Graph

When Britney Spears was 17 years old, her first album …Baby One More Time, was unconfined and rapidly reached #1 spot on the pop charts. And Britney Spears second one album, Oops!...I Did It Again , which was released on May 2002 and her 3rd album, In the Zone (2003) sold several millions of copies.

Britney Spears is a famous American singer. Britney Spears became a cultural image and also a divisive role model for the millions of young girls in 1990s and early 21st Century. And after the releasing of Britney Spears primary hit album, Spears became the key element in the resumption of "teen pop" melody in late 1990s.

When Britney Spears began her career, Britney Spears promoted the icon of virginal morality. This ultimately gave the way to her recent sexually evocative, an adult icon. It caused many several parents of teen and also pre-teen female admirers to lose the eagerness they had initially shown in the direction of Britney Spears’s virginal icon.

Britney Spears sexually evocative music videos obtained almost Constant coverage through MTV. It attached with the concert tours holding vulgar dance members. It caused Spears to become an icon of Overcharged teen sex in late 1990s and early 21st century.

Britney Spears is famous for her songs, studio albums, and music videos. Britney Spears reputation led her to try out with additional forms of media, like movies and reality TV shows. Britney Spears had her flaxen share of low phrases and achievement however Britney Spears has managed to seize the consideration of media with her each movement.

Some of the main single album of Britney Spears comprises In the Zone, Britney, Oops! I Did It Again, Baby One More Time, Greatest Hits: My Prerogative and more. Britney Spears has attended May music global tours like Dream Within a Dream Tour, Baby One More Time Tour, Crazy 2k Tour, Zone Mall Tour, and among others. Britney Spears has been the receiver of many music awards like impressive Grammy Awards and many others.

Britney Spears is considered as the 8th best-selling feminine recording artiste in US. According to the Recording Industry Association of America with 31 million licensed albums and one of the world's best-selling music artists have sold about 83 million records universal. Britney Spears holds the label to multiple Guinness World Records.

Britney Spears Private Life

Britney Spears wedded with the stage dancer and backup singer Kevin Federline in Las Vegas in September, 2004. Britney Spears gave the birth to a son, Sean Preston Federline, was born on 14th September, 2005. On 12th September, 2006, Britney Spears gave birth to the second son, Jayden James Federline. And on 7th November, they separated from each other.

For the period of January and February of 2007, the media reported on Britney Spears’s odd behavior. In the year of 2007, Britney Spears was found drugged and alcohol used.

Despite the divisive and sad performance at MTV Award show, Britney Spears unconfined a new album, Blackout, in October, 2007, to optimistic reviews.

Britney Spears Education:

Professional - Performing Arts School (New York City)

Discography of Britney Spears

Studio albums

1999: ...Baby One MoreTime
2000: Oops!... I Did It Again
2001: Britney
2003: In the Zone
2007: Blackout 2008: Circus

Other albums

2004: Greatest Hits: My Prerogative
2005: B in the Mix: The Remixes

EPs

2005: Chaotic

Videos/DVDs

1999: Time Out with Britney Spears
2000: Live and More!
2001: Britney: The Videos
2002: Live from Las Vegas
2004: In the Zone
2004: Greatest Hits: My Prerogative
2005: Britney & Kevin: Chaotic


Britney Spears Tours
  • 1999: ...Baby One More Time Tour
  • 2000: Crazy 2K Tour
  • 2000: Oops!... I Did It Again World Tour
  • 2001-2002: Dream Within a Dream Tour
  • 2004: The Onyx Hotel Tour
  • 2007: The M+M's Tour
  • 2009: The Circus Starring: Britney Spears
Filmography of Britney Spears
YearTitleRoleNotes
1991The MickeyMouse ClubVarious RolesSeasons 6-7, 1991-1993
1999The FamousJett JacksonHerselfShe sang "...BabyOne More Time" on the show.
Sabrina theTeenage WitchHerselfCameo
2000LongshotFlight AttendantCameo
2002Austin Powersin GoldmemberHerselfCameo/Soundtrack
CrossroadsLucy WagnerLead Role/Feature Film
Robbie theReindeer in Legend of the Lost TribeDonnerEnglish version/Animation
2004Britney &Kevin: ChaoticHerselfReality Show
2006Will &GraceAmber-LouiseEpisode "Buy, Buy Baby"
2008How I MetYour MotherAbbySeason 3:"Ten Sessions" and "Everything Must Go"


Saturday, November 29, 2008

BIRTHDAYS: Sarah Silverman (Birthday 1st December), Famous American Actress & Comedian, Biography of Sarah Silverman on Career, Personal Life & Awards

Sarah Kate Silverman an American actress, singer, comedian, guitarist and comedian was born on 1st December, 1970 in Bedford, New Hampshire. Sarah Silverman is sometimes acclaimed through her nickname, Big S. and her ironic comedy addresses the social controversial and taboos issues such as religion, sexism, and racism.

Sarah Silverman frequently presents her act as a cartoon of Jewish-American princess, sardonic stereotypes and bigotry of religious denominations and ethnic groups, through approving them in a satirical fashion. Sarah Silverman was first noted as an occasional performer and writer on Saturday Night Live. Now Sarah Silverman produces The Sarah Silverman Program, which debuted 1st February, 2007, on the Comedy Central.

Biography of Sarah Silverman

Sarah Silverman Early life

Sarah Silverman is the daughter of Beth Ann Halpin, a photographer and Donald Silverman, a societal worker. Sarah Silverman family is Jewish. Sarah Silverman emerged in the Public Theater at the age of 12. Sarah Silverman joined The Derry field School in Manchester, New Hampshire. And at the age of 17, Sarah Silverman presented slapstick comedian in an eatery, singing the song Sarah Silverman called "Mammaries". Then Sarah Silverman attended the New York University and carried on her wit in Greenwich Village.

Sarah Silverman Career Graph

Sarah Silverman first obtained the national awareness in 1993-94 season of Saturday Night Live, as a featured player and writer. Bob Odenkirk, an earlier SNL novelist explained:

“I could see how it wouldn't work at SNL because she's got her own voice, she's very much Sarah Silverman all the time. She can play a character but she doesn't disappear into the character -- she makes the character her”.

Sarah Silverman alleges that she was deeply disturbed when SNL fired up her via fax. Sarah Silverman parodied the condition when Sarah Silverman emerged on The Larry Sanders Show episode "The New Writer" (1996), playing Sanders' new staff critic, whose wits are not used because of the bias and chauvinism of a male chief humor writer, who supports the funny stories of his male co-writers. Sarah Silverman had the chronic role on the Larry Sanders for its very last 2 seasons.

Sarah Silverman was the featured presenter on the HBO sketch comedy show Mr. Show (1995-97). Sarah Silverman formed television program the Guest appearances on Seinfeld, in an episode "The Money" (1997); on Star Trek: Voyager, in two-part time voyage episode "Future's End" (1996); on the Greg the Bunny as a series usual (2002); and on the puppet TV comedy Crank Yonkers, as the tone of Hadassah Guberman (2003, 2007). Sarah Silverman had small roles in the movies Overnight Delivery, Heartbreakers, Screwed, Evolution, Say It Isn't So, The Way of the Gun, School of Rock, Rent, School for Scoundrels, and There's Something About Mary, playing a combination of serious and comic roles. And her stand-up comedy act, one-woman show, was unconfined in 2005 as a feature film, Sarah Silverman: Jesus Is Magic. In the year of 2005, Sarah Silverman played a therapist in the skit for the bonus DVD of an album Lullabies to Paralyze through the band Queens of the Stone Age.

In 2006, Sarah Silverman placed #50 on Maxim Hot 100 List. And in the year of 2007, Sarah Silverman placed #29 and also emerged on the wrap. Sarah made the wrap of The Observer in Britain, with an object naming her "the world's hottest, most controversial comedian".

On 9th September, 2007, Sarah Silverman emerged at MTV Video Music Awards. After the comeback performance of Britney Spe4ars, Sarah Silverman ridiculed her on the stage, stating, "Wow, she is amazing. I mean, she is 25 years old, and she has already accomplished everything she's going to accomplish in her life. It's mind-blowing." Sarah Silverman called Spears' kids "the most adorable mistakes you will ever see" and emulated Spear’s vagina with her mouth.

On 31st January, 2008, Sarah Silverman emerged as the guest on Jimmy Kimmel Live! a special video of her boyfriend, Jimmy Kimmel. And this video rotated to be the song called "I'm Fucking Matt Damon", in which Damon and Sarah sang a duo about having a matter behind Kimmel's back. And the video produced an "instant Youtube commotion". Kimmel précised his video "revenge" on 24th February, 2008 through airing the video cast at Sarah Silverman which enlisted the panoply of stars to record Kimmel’s song "I'm Fucking Ben Affleck" on 13th September, 2008, Sarah Silverman achieved an Emmy award for writing the song "I'm Fucking Matt Damon".

In October 2008, Sarah Silverman visited the Great Britain to advertise the discharge of The Sarah Silverman Program on the Paramount Comedy; however her stage performance and media botched to impress viewers.

Sarah Silverman: Jesus Is Magic

Sarah Silverman’s concert movie, Sarah Silverman: Jesus Is Magic, which is based on an one-woman show. It was unconfined in the year of 2005. Liam Lynch produced the film, issued through Roadside Attractions.

Rotten Tomatoes gave Jesus Is Magic a "fresh" rating of 64 % with 54 affirmative reviews and 30 negative ones. It produced US$124,475 on its first weekend, showing on the seven screens. And the box office presentation directed to a prolonged discharge in 57 theaters, ensuing in the box office take of additional than US$1.3 million.

And this film was unconfined on 6th June, 2006.

Sarah Silverman Personal life

In February 2007 magazine article stated that Sarah Silverman was in the relationship with Jimmy Kimmel. Sarah Silverman referred to the connection in several of her farce:

“I'm Jewish, but I wear this Saint Christopher medal sometimes; my boyfriend is Catholic -- but you know... it was cute the way he gave it to me. He said if it doesn't burn a hole through my skin it will protect me.”

And in July 2008, Vanity Fair earliest gave a statement that Kimmel and Sarah Silverman had finished their relationship. But in October, 2008, People Magazine and FOX News reported that they were on the way together. And they attended the marriage of Howard Stern together.

Sarah Silverman is an admirer of Jenny Lewis and emerged in the music video of Lewis for a song “Rise Up With Fists!!” Sarah Silverman is an admirer of comedian Steve Martin.

Filmography of Sarah Silverman

Features:
  • Who's the Caboose? ( 1997)
  • Bulworth ( 1998)
  • Overnight Delivery ( 1998)
  • There's Something About Mary ( 1998)
  • The Bachelor ( 1999)
  • Screwed ( 2000)
  • What Planet Are You From? ( 2000)
  • The Way of the Gun ( 2000)
  • Say It Isn't So ( 2001)
  • Black Days ( 2001)
  • Evolution ( 2001)
  • Heartbreakers ( 2001)
  • Run Ronnie Run ( 2002)
  • School of Rock ( 2003)
  • Hair High ( 2004) (voice)
  • Rent ( 2005)
  • The Aristocrats ( 2005) (documentary)
  • ( 2005)
  • School for Scoundrels ( 2006)
  • I Want Someone to Eat Cheese With ( 2006)
  • Certifiably Jonathan ( 2007) (documentary)
  • '' ( 2007)
  • Fired! ( 2007) (documentary)
  • Comedy Central Roast of Bob Saget (2008) (television program)
  • Super High Me ( 2008) (documentary, cameo)
Short Subjects:
  • Strippers Pole ( 2002)
  • Supermarket ( 2004)
  • Nobody's Perfect ( 2004)
  • Give The Jew Girl Toys (satirical music video)
Television work of Sarah Silverman
  • Saturday Night Live (cast member, 1993–1994)
  • Mr. Show (featured performer, 1995)
  • The Larry Sanders Show (1994—1996)
  • Star Trek Voyager (" Future's End", two episode arc, 1996)
  • Seinfeld (" The Money", 1997)
  • Dr. Katz, Professional Therapist (voice as herself, "Alderman", 1998)
  • Late Last Night (1999)
  • Smog (unsold pilot, 1999)
  • Super Nerds (unsold pilot, 2000)
  • Futurama (" The Cryonic Woman", 2000)
  • Rocky Times (unsold pilot, 2000)
  • Greg the Bunny (2002–2004)
  • Crank Yonkers (voice, 2002— )
  • Frasier (Jane, "Maris Returns", 2003)
  • Entourage (herself, 2004)
  • Pilot Season (miniseries, 2004)
  • Aqua Teen Hunger Force (" Rob sitter", 2004, credited as Big S)
  • Drawn Together (" The Other Cousin", episode 1.5, 2004)
  • Monk (Mr. Monk and The T.V Star, 2004)
  • American Dad! (" Stan Knows Best", 2005, voice)
  • Tom Goes to the Mayor ("Pipe Camp", episode 11, 2005)
  • Celebrity Poker Showdown (two times, 2003— )
  • ''Comic Relief (stand-up segment 2006)
  • The Andy Melonakos Show (herself, 2007)
  • Monk (Mr. Monk's Biggest Fan, 2007)
  • The Sarah Silverman Program (2007— )
  • 8 out of 10 cats ("Herself", 2008)
  • Monk ("Mr. Monk's 100TH Case", 2008)
  • WWE Monday Night RAW ("Herself", 2008)
  • Friday Night with Jonathan Ross ("Herself", 2008)

Thursday, November 27, 2008

BIRTHDAYS: Christopher Paolini (Birthday 17th November), Famous American Novelist, Biography of Christopher Paolini on Career, Personal Life

Christopher Paolini was born on 17th November, 1983 and is famous American Writer. Christopher Paolini is known as the author of Inheritance cycle that includes the books Eldest, Brisingr, Eragon and also his fourth book which is yet untitled. Christopher Paolini lives in Montana in the Paradise Valley and there only Christopher Paolini wrote his initial book. Christopher Paolini rose up by listening up the multiplicity of the music but the classical music ablaze his imagination and also helped him in writing. Generally Christopher Paolini listens to Wagner, Mahler and Beethoven at the time of writhing Eragon. The last battle of his book was written after listening to the Carmina Burana.

Biography of Christopher Paolini

Christopher Paolini was raised in the Montana in the area of Paradise valley. Christopher Paolini family members consists of his father Kenneth Paolini, his mother Talita Hodgkinson and Angela Paolini, his sister. Christopher Paolini graduated at age of fifteen years from high school through the set of the qualified correspondence courses in Illinois from American School of Correspondence. Subsequently graduation, Christopher Paolini began working on the novel Eragon, the first series which was set in Alagaesia kingdom.

Eragon was published by the Christopher Paolini International LLC in the year 2002 which was the company of Christopher Paolini’s parents. For promoting his book, Christopher Paolini toured near about 135 libraries and schools, discussing the writing and reading. Christopher Paolini also shaped the cover painting for the first edition of the Eragon that featured Saphira’s eye. Paolini also drew maps on inside the covers of the book.

In the year 2002, stepson of the Carl Hiaasen, who was the author, found Christopher Paolini’s book Eragon the book store and appreciated it. Christopher Paolini recently brought this to the attention of Alfred A. Knopf, his publisher. Alfred consequently made the offer for publishing Christopher Paolini book and rest of Inheritance cycle. Eragon second edition was published by Alfred in the year 2003. Christopher Paolini became the author of New York Times bestselling at the only age of 19 years. Christopher Paolini’s essay named as It All Began with Books was incorporated in the anthology of the year 2005 Guys Write for Guys Read. The sequel of the Eragon, Eldest was released in the year 2005. Christopher Paolini third book Brisingr was released in the mid of the year 2008. Though Inheritance cycle was designed as the trilogy, information of the Brisingr had been expanded to incorporate the 4ht book which is not titled yet.

Influences:

The literary inspirations of the Christopher Paolini’s consist of the works of Beowulf, E.R. Edison and J.R.R. Tolkien. Christopher Paolini said that his first book Eragon was inspired particularly with work of Bruce Coville. The other inspirations consist of the Andre Norton, Raymond E. Feist, Brain Jacques, Ursula K. Le Guin, Frank Herbert, David Eddings and Anne McCaffrey. The other favourite authors consists Garth Nix, Jane Yolen and Philip Pullman.

The writing of the Christopher Paolini is influenced much more by the nature. In the interview with Tamora Pierce and Philip Pullman, Christopher Paolini said that the main source for his inspiration is the Paradise Valley of Montana. In his book Eldest, Christopher Paolini described his elf as the vegetarian but when asked about the diet he said that he is not vegetarian but is also lean in that direction.

Christopher Paolini Authors’ Profile:

Christopher Paolini writes not only about the fantasy, but he lives in it. When Christopher Paolini was only 15 years of age, Christopher Paolini penned the sweeping epic termed as the Eragon which eventually was discovered by the publisher of the New York and also by the large number of the readers. His book nestled very comfortably on the lists of the bestseller in the year 2003 and by the year 2004 the movie which was based on the dazzling blue dragon and wonderful tale of the boy was poised for taking the flight. Christopher Paolini was also very hard at writing of the 2nd and 3rd instalments in Inheritance trilogy.

Writer of Dragon:

Christopher Paolini generally found himself in the daydreaming about the dragons at the time when Christopher Paolini was bathing, doing his homework of even when driving the car. Whereas Christopher Paolini was growing up he started to capture his daydreams on the papers, writing short stories and papers which featured the dragons and were also set in the magical places.


BIRTHDAYS: Amare Stoudemire (Birthday 16th November), Famous American Basketball Player, Biography of Amare Stoudemire on Career, Personal Life

Amare Carsares Stoudemire was born on 16th November, 1982 and is the famous American basketball player for NBA’s Phoenix Suns. Amare is 6ft 10 in and 249 lb power centre/forward.

Amare Stoudemire Early Life and Career:

Amare Stoudemire father died when Amare Stoudemire was only twelve years old and at that time also his mother was out and in of the prison. As result, Amare Stoudemire attended six of the different high schools before completing his graduation from Cypress Creek High School. In an article to the Dime Magazine, Amare Stoudemire told to Isaac Perry that the only thing which helped him in going at that time was the words of Tupac Shakur who was the rapper and the God. Amare Stoudemire did not begin playing the structured basketball, till Amare Stoudemire was fourteen years of age. Amare Stoudemire only played basketball at the high- school level for two years but particularly in those of the two years, Amare Stoudemire was named as MVP of summer league of Nike. At that time Amare Stoudemire accepted to play basketball for the University of Memphis but Amare Stoudemire never attended school.

In spite, Amare Stoudemire declared for NBA breeze due to this aspiration for helping his family as quickly as possible. Phoenix Suns took the decision on him with the 9th pick in NBA draft of the year 2002 because of the requirement of the internal strength in that particular time. In that particular year the only team to choose the high school contestant in first round was the Phoenix.

In the year 2002, Amare Stoudemire averaged 8.8 rebounds and 13.5 points per game and also scored the highest 38 points beside Minnesota Timberwolves. It was the highest score which was afterwards broken by the LeBorn James. Amare Stoudemire also won the award for the NBA’s Rookie of year for beating Miami Heat and Yao Ming the centre and Caron Butler the forward players of Houston Rockets and also became the first ever draft player of the high school for winning award.

The subsequent season, Amare Stoudemire improved statistically and in the year 204, Amare Stoudemire was sleeted in the national team of US in Summer Olympics of the year 2004. Nevertheless, Larry Brown, the head coach of the team decline to provide him the considerable time for playing. At the time of the NBA season of the year 2004-05, Amare Stoudemire teamed with the Steve Nash who was the point guard to lead with the record of 62-20. In that year Amare Stoudemire achieved the novel career height of fifty points in the year 2005 against Portland Trial Blazers. Amare Stoudemire was also chosen as the reserve forward for National Basketball Association All- Star Game.

Amare Stoudemire Profile:

At 250 lbs and 6’10”, Amare is the natural power forward. Nevertheless, gun style and run of Sun’s meant and Amare Stoudemire often begin at the centre prior to acquisition of the Shaquille O’Neal, in spite being under developed for position. In the year 2007-08, Amare Stoudemire averaged near about 25.2 points in every game. Nevertheless his 59.0% of the field gold was highest among top ten scorers in NBA. The efficient scoring of Amare Stoudemire is credited to his effectual use of roll and pick with Steve Nash, point guard. Amare Stoudemire also gets to line of free throws commonly, where Amare converts high of 80.5% clip.

Amare Stoudemire - Honours and Awards:
  • NBA all stars in the year 2005, 2007 and 2008
  • All- NBA first team in the year 2007
  • All- NBA Second Team in the year 2005 and 2008
  • NBA Rookie of the year 2003
  • NBA All- Rookie first team in the year 2003
  • NBA All- Star Rookie Challenge MVP in the year 2004
2006-07 seasons:

Before the seasons 2006-07, Amare Stoudemire changed his pullover from the number 32 to 1. The number 1 jersey was worn last in the previous season by Dijon Thompson. Amare Stoudemire joined the national team of US and started his practice with worldwide team but Amare Stoudemire was dropped from squad for trip to Asia as Mike Krzyzewski, the coach of the team believed that Amare Stoudemire needed the proper chance to recover fully from his injuries of the Knee.

BIRTHDAYS: Jack Ingram (Birthday 15th November), Famous American Singer & Songwriter, Biography of Jack Ingram on Career, Personal Life & Awards

Jack Owen Ingram was born on 15th November, 1970 and is the famous American music performer. Jack Ingram has released more than 12 singles for the country radio and recorded near about 7 studio albums. Though from the year 1992, Jack Ingram did not attain considerable attention till year 2005, but Jack Ingram was again in the news after release of wherever You Are which was the super hit on the Billboard on charts of the country. Jack Ingram this single was first of the 5 top twenty five hits and was also the number 1 hit for the act on label of Big Machine Records. This was the song which was followed by the Love You and the cover of the Lips of an Angel.

Biography of Jack Ingram

Jack Ingram made the living touring among Houston and Dallas and also released large number of the self- governing albums. Jack Ingram was born in Texas in Houston. At the time of the independent period of career, Jack Ingram got opening hit on country charts of US with the Flutter. Jack Ingram played seriously when Jack Ingram was studying Psychology in Dallas at the Southern Methodist University. Jack Ingram also toured around roadhouses and bars of the Texas with his band.

In the year 2005, Jack Ingram signed to self- governing Big Machine Records label. Under this banner, Jack Ingram released the live album wherever you are which was first hit for him. This single was his first album and became the first top 40’s for him and afterwards it became the first number single on charts of the hot country songs on the Billboard of US. This was the song which also was recorded by the New Row Mob and Trent Summar.

Jack Ingram released the cover of the song Lips of an Angel in the year 2006. Owen this cover peaked at position 16 on charts of the country and also was the lead off the single to this is it which was Jack Ingram second album that he released for Big Machine. Jack Ingram also won the award for the top male vocalist in the year 2008 for in academy of Country Music. Jack Ingram was also filled in place of the Bob Kingsley who was the radio host on the show Bob Kingsley’s Country Top 40 for week.

Discography of Jack Ingram

Jack Ingram Studio Albums:
  • Jack Ingram in the year 1992
  • Lonesome Questions in the year 1995
  • Livin or Dyin in the year 1997
  • Hey you in the year 1999
  • Electric in the year 2002
  • Electric: extra volts (EP) in the year 2003
  • Young Man in the year 2004
  • This is it in the year 2007
Jack Ingram Live albums:
  • Live at Adair’s in the year 1995
  • Unleashed Live in the year 2000
  • Live at Billy Bob’s Texas in the year 2003
  • Live at Gruene Hall: Happy Happy in the year 2004
  • A coustic model in the year 2005
  • Live: Wherever you are in the year 2006
Jack Ingram Singles:
  • Flutter in the year 1997
  • That’s not me in the year 1997
  • Mustang Burn in the year 1998
  • How Many Days in the year 1998
  • Barbie Doll in the year 2000
  • A Little Bit in the year 2002
  • One Thing in the year 2002
  • Keep on keepin on in the year 2003
  • Wherever you are in the year 2005
  • Lips of an Angel in the year 2006
  • Love you in the year 2006
  • Measure of a Man in the year 2006
  • That’s man in the year 2008
  • Measure of a man in the year 2007
  • Maybe she’ll get Lonely in the year 2007
Jack Ingram - Nominations and Awards:
  • Won CMT Music Award in the year 2007 for Wide Open Video of the year
  • Won Academy of Country Music in the year 2008 for top new male vocalist
  • Nominated for CMT Music Award in the year 2008 for Wide Open Video of the year

BIRTHDAYS: Travis Barker (Birthdays 14th November), Famous American Drummer, Biography of Travis Barker on Career, Personal Life, & Achievements

Travis Landon Barker was born on 14th November 1975 and is the American Drummer. Travis Barker gained the fame while playing his band in Blink- 182. Travis Barker also works for the +44 and Travis Barker also has many side projects including Transplants, Expensive Taste and Box Car Racer. Travis Barker joined the first on tour band in the year 1996, where Travis Barker plays the drums for Aqua bats as Baron Von Tito. Travis Barker also recorded album named The Fury of the Aqua bats with them in the year 1997. Travis Barker career rose when he joined the band, Blink 182 in the year 1998. Travis Barker was famously known for the Mohawk and also for his tendency for performing without the shirt and also revealing the multitude of the tattoos. Travis Barker also established himself as versatile drummer, guest appearing and producing in the projects of music including the alternative rock, ska pop, hip-hop and punk rock.

Travis Barker also founded the clothing company named as Famous Stars and Straps in the year 1994, Wahoo’s Fish Taco restaurant in the year 2004 and also the LaSalle Records in the same year. Travis Barker got married to the Shanna Moakler, who was the former Miss USA and she featured in the MTV’s Meet the Barkers. Barker’s personal life and marriage is considerable media silage following divorce in the year 2008 and connection with Paris Hilton.

Travis Barker Early Life

Travis Barker was born in California and is the son of Gloria and Bob Barker. Travis Barker got the first set of the drum when Travis Barker was only 4 years old. Travis Barker started taking the trumpet and drum lessons when Travis Barker was 5 years old. A day before Travis Barker started freshman year at High School of Fontana, Barker’s mother died. Travis Barker mother told him to continue playing the drums because she wants him to be good at it and Travis Barker obeyed his mother. After the death of his mother, Travis Barker became more severe about drumming. Travis Barker joined the marching band in the sophomore year and Travis Barker also created the snare line. At the time of the high school days Travis Barker performs at festivals and competitions. After having the graduation from the high school, Travis Barker gained much more experience as the rock drummer. Afterwards Travis Barker was named as Baron von Tito.

Blink- 182

In the year 1998, Travis Barker tour with The Aqua bats under stage which was named as “The Baron Von Tito”. This band was also on bill and at the time when Scott Ray nor was detached from band, Travis Barker was asked to fill the place. This needs the barker to learn the complete set in 2 hours and execute it at night show. Travis Barker hard works earned much respect and appreciation and also the offer for joining the Blink- 182 band which Travis Barker accepted.

Travis Barker Musical Equipments

Travis Barker is recently endorsed by Ziladjian and Percussion Orange County drums.
  • 10x12” Rack tom
  • 14x16” Floor tom
  • 20” oriental china crash cymbal
  • 21” a sweet ride brilliant finish
  • 6.5x 14” snare drum
  • 22x24” bass drum
  • 19” a medium thin crash cymbal
  • 14” a custom master sound hi- hats
This is the set up which is used chiefly with the Blink 182 band but Travis Barker used 10x8”rack tom and 16x16”floor tom in the studios and also 10” custom splash cymbal. Travis Barker used Ziladjian K rides with +44 tours and Travis Barker replaces China with 17” thin crash.

Discography of Travis Barker
  • The fury of the aqua bats in the year 1997
  • Enema of the states in the year 1999
  • The Mark, tom and Travis show: The Enema Strikes back in the year 2000
  • Take off your pants and jackets in the year 2001
  • Transplants in the year 2002
  • Box car racer in the year 2002
  • Try this in the year 2003
  • Blink- 182 in the year 2002
  • Black in the mud in the year 2004
  • Greatest hits in the year 2004
  • Haunted cities in the year 2005
  • King in the year 2005
  • Trill in the year 2005
  • Pump it in the year 2006
  • Wolves in the year 2006
  • Get money; stay true in the year 2006
  • Umbrella in the year 2007
  • Black roses in the year 2007
  • Don’t touch me in the year 2007
  • Fix your face in the year 2008
  • Got money in the year 2008


BIRHDAYS: Anne Hathaway (Birthday 12th November), Famous American Actress, Biography of Anne Hathaway on Career, Personal Life & Anne Hathaway Awards

Anne Jacqueline Hathaway was born on 12th November 1982 and is the American actress. Anne Hathaway made her debut career in the year 1999 with the television series Get Real but Anne’s first famous role was in the Princess Diaries which was family comedy show of the Disney’s in the year 2001 where her co- starred was Julie Andrews. This comedy show helped her in making her career. In the following 3 years Anne Hathaway continued to work in the family films with having the lead role in The Princess Diaries 2 and Enchanted in the year 2004. Later Anne venture from “G- rated” image and her former acting career bestow her, working in the adult- themed movies Brokeback Mountain and Havoc.

Anne Hathaway Early Life:

Anne Hathaway was born in New York in Brooklyn but at the age of 6 moved to New Jersey. Anne Hathaway is daughter of Mc Cauley who was the actress and Gerald Hathaway who was the lawyer. Anne Hathaway mother inspired her to follow her footsteps. Anne Hathaway was named after William Shakespeare’s wife. Anne Hathaway also had the younger brother named Thomas and the Elder Brother named Michael. Anne Hathaway chiefly has the French and Irish descent, with more isolated Native American and German roots. Anne Hathaway was raised as the Catholic as Anne Hathaway considered as the strong values and stated that Anne Hathaway wants to become the nun at the time of her childhood. Nevertheless, at 15 years of age Anne Hathaway took the decision not to be the nun after getting knowledge that Michael, her brother is gay but Anne Hathaway stated that Anne Hathaway is the non- denominational Christian.

Anne Hathaway was the very intelligent child and was also involved in the program of Montessori as preschooler and then Anne Hathaway was only able to pierce the first grade. Anne Hathaway completed her graduation from the Millburn High School and there Anne Hathaway participated in several school plays. Anne performed in large number of plays as the Gigi and Jane Eyre at the Paper mill playhouse in New Jersey. Anne Hathaway performance as the Winifred in the Once upon a Mattress granted het the nomination award of the New Jersey Rising Star from community theatre as for the best performance by the actress of the high school. Anne Hathaway spent large number of the semesters studying as women’s studies trivial and English major in Poughkeepsie at Vassar College.

Anne Hathaway Career Development:

Anne Hathaway starred in series of the FOX television Get Real in the year 1999 for the particular one season, which was afterwards cancelled. Anne Hathaway got first role in the film in the year 2001 as Jean Sabin in The other Sides of Heaven, where Anne Hathaway worked opposite Christopher Gorham. Anne Hathaway also auditioned for the role at the time of the flight layover and Anne Hathaway got the role after one audition only.

Anne Hathaway started giving voice to the auditory books of The Princess Diaries in the year 2002. Anne Hathaway has given her voice three times to series. In the same year, Anne Hathaway provided her voice to the character Haru, in English description of the Hiroyuki Morita’s in The Cat Returns. Anne Hathaway also worked with the star Brian Stokes Mitchell in City Centre encores in year 2002. Anne Hathaway also got the very optimistic reviews for her depictions of Lili.

Anne Hathaway Personal Life:

Anne Hathaway started her relationship in the year 2004 with Raffaello Follieri who was the real estate developer of Italy. At the time of her relationship with him, Anne Hathaway participated in development of generous Follieri Foundation where Anne Hathaway served as the financial donor and also the member of the foundation till the year 2007. Anne Hathaway is involved with the large charities which consist of The Step up Women’s Network, The Human Rights Campaign, the Creative Coalition, The Lollipop Theatre Network and St. Jude Children’s Research Hospital. Anne Hathaway was honoured for fantastic work with the human rights Campaign and The Step up women’s Network.

Filmography of Anne Hathaway

Anne Hathaway Films:
  • Get real in the year 1999
  • The Princes Diaries in the year 2001
  • The other side of heaven in the year 2001
  • The cat returns in the year 2002
  • The prince’s diaries 2 in the year 2004
  • Havoc in the year 2005
  • Brokeback Mountain in the year 2005
  • The Devils wears Prada in the year 2006
  • Becoming Jane in the year 2007
  • Get Smart in the year 2007
  • Passengers in the year 2008
  • Rachel Getting Married in the year 2008

BIRTHDAYS: Leonardo DiCaprio (Birthday 11th November), Famous American Actor, Biography of Leonardo DiCaprio on Career, Personal Life, & Awards

Leonardo Wilhelm DiCaprio was born on 11th November 1974 in California and is also 3 times nominated for Academy Award. Leonardo DiCaprio is also winner of Golden Globe. Leonardo DiCaprio is a famous Hollywood actor of America and gained fame for his remarkable appearance in Titanic as Jack Dawson. Leonardo DiCaprio also appeared in many of the other successful movies which include Catch me if you can, Blood Diamond and Romeo & Juliet. Leonardo also worked in the current films The Aviator, The Departed and Gangs of New York of Martin Scorsese’s, causing the general people to compare his relationship with actor Robert De Niro which benefited Leonardo career. Leonardo DiCaprio has also been nominated for BAFTA two times, for SAG three times and Leonardo DiCaprio is also the winner of the Silver Bear Award.

Leonardo DiCaprio Early Life

Leonardo DiCaprio was born in California in Los Angles and also is the only child of Irmelin Indenbirken and George Di Caprio. At the time of his childhood Leonardo DiCaprio mother moved to the Germany from Oer- Erkenschwick. Leonardo DiCaprio parents met in the college and moved to the Los Angles. Leonardo DiCaprio was named after the famous artist Leonardo da Vinci as her mother at the time of pregnancy was standing in front of the Vinci painting in the museum at Italy when Leonardo DiCaprio first kicked. When Leonardo DiCaprio was one year old he parents got divorced. Mostly Leonardo DiCaprio lived with Irmelin, his mother but his father George was also around him intermittently. At the time of his childhood, Leonardo DiCaprio attended the School of Seeds Elementary. Leonardo DiCaprio was having a very keen interest in comic books, baseball and commonly visits the museum with George, hid father.

Leonardo DiCaprio Early Career

Career of Leonardo DiCaprio started with appearing in many educational and commercials films. In the year 1990, Leonardo DiCaprio got break on the television when Leonardo DiCaprio got role in series of the short lived which was based on film Parenthood. There Leonardo DiCaprio met the other child artist Tobey Maguire who was also struggling. Both of them quickly became friend and also made the pact for helping each other in finding the roles in the movies and television.

Superstardom:

Leonardo DiCaprio became superstar in the year 1997 after playing the role of Jack Dawson in movie Titanic co- starring with Kate Winslet who was playing the role of Rose De Witt Bukater, rapidly which became the largest grossing film and also received 11 Oscars. Over work of the next some of the years, Leonardo DiCaprio became the domestic name globally and was also labelled with the synonymous names as sex symbol, most beautiful eyes and Teenage heart-throb.

Leonardo DiCaprio Status and Income

Leonardo DiCaprio was named as the 5th largest paid artist in the Hollywood in the year 2008. The people magazine named Leonardo DiCaprio as “One of the fifty most beautiful persons in the entire World.” The time magazine named Leonardo as “one of the most influential persons in the entire globe and Leonardo DiCaprio was also placed on position 36 on the Empire Magazine’s for”100 Sexiest Movie Stars”.

Leonardo DiCaprio Personal Life

Leonardo DiCaprio dated with supermodel of Brazil Gisele Bundchen from the year 2001 to year 2005. Leonardo DiCaprio also dated with Vanessa Hayden, Helena Christensen, Kristen Zang and Sara Foster. Leonardo DiCaprio is close friend with the Kate Winslet, his titanic co star and Tobey Maguire. Leonardo DiCaprio is also good friend with the Adrian Grenier, Kevin Connolly, Lukas Haas, Vincent Gallo and Mark Wahlberg.

Filmography of Leonardo DiCaprio

Leonardo DiCaprio Films:
  • Critters 3 in the year 1991
  • This Boy Life in the year 1992
  • The Basketball Diaries in the year 1995
  • Romeo and Juliet in the year 1996
  • Titanic in the year 1997
  • Celebrity in the year 1998
  • The Beach in the year 2000
  • Don’s Plum in the year 2001
  • The aviator in the year 2004
  • The Departed in the year 2006
  • The 11th Hour in the year 2007
  • Revolutionary Road in the year 2008
Leonardo DiCaprio - Nominations and Awards

Academy Award:

Nominated for best supporting actor in the year 1004 for what’s eating Gilbert Grape
Nominated for best actor in the year 2005 for The Aviator
Nominated for best actor in the year 2007 for Blood Diamond

Golden Globe Award:

Nominated for best supporting actor for what’s’ eating Gilbert Grape in the year 1994
Nominated for best actor for Titanic in the year 1997
Nominated for best actor for catch me if you can in the year 2003
Won best actor award for The Aviator in the year 2005
Nominated for best actor for Blood Diamond in the year 2007
Nominated for best actor for The Departed in the year 2007

Wednesday, November 26, 2008

BIRTHDAYS: Clay Aiken (Birthday 30th November), Famous American Pop Vocalist, Biography of Clay Aiken on Career, Personal Life, Awards & Achievements

Clay Aiken an American pop vocalist was born on 30th November, 1978 in Raleigh, North Carolina. Clay Aiken went to the IInd season on TV program American Idol in the year of 2003. Founded on album retailing surpassed through Idol winners Carrie Underwood and Kelly Clarkson, Clay Aiken has become the flourishing male and runner-up in the history of the show.

Biography of Clay Aiken

Clay Aiken Private life

As a child, Clay Aiken sang in Raleigh Boy choir. As a young boy, Clay Aiken sang in academy choir, church choir, local theatre and musicals productions. After his school days, Clay Aiken sang with the local band, Just By Chance, and also co hosted and performed with the group at “Just by Chance and Friends” shows in Dunn, North Carolina. Clay Aiken also performed the nationalized anthem several times for Raleigh Ice Caps and also Carolina Hurricanes.

Clay Aiken joined Raleigh's Leesville Road High School and took the courses at Campbell University before registering at University of North Carolina at Charlotte. Clay Aiken showed his curiosity in special edification while casting YMCA kids’ camps as an adolescent. While joining college in Charlotte, Clay Aiken took the part-time work as a helper to a lad with the autism, and it was the child’s mom, Diane Bubal, who advised him to trial for the American Idol. Though the American Idol activities provisionally delayed his educational pursuits, Clay Aiken finished his course work during on tour and he graduated with the bachelor's degree in special education in December 2003.

Clay Aiken proclaimed on his private blog: "My dear friend, James, and I are so excited to announce the birth of Parker Foster Aiken" Clay’s son was born on 8th August, 2008 in North Carolina. And the mother of the child is Jaymes Foster; she is the sis of record maker David Foster. Jaymes has been managerial producer of Clay Aiken’s last 3 albums. “The little man is healthy, happy, and as loud as his daddy," Clay Aiken wrote. "Mama James is doing quite well also." Clay Aiken stated in his manuscript, Learning to Sing: Hearing the Music in Your Life, that "It's a Southern tradition to be given your first name from your grand mama’s maiden name."

After many years of community speculation, Clay Aiken verified, in September 2008 meeting with the People magazine that he is gay.

Clay Aiken Career

After the American Idol appearance, Clay Aiken has launched 8 tours, authored the New York Times best-selling manuscript Learning to Sing: Hearing the Music in Your Life with Allison Glock, and Clay Aiken was a managerial producer for 2004 televised Christmas special, A Clay Aiken Christmas. Clay Aiken has been common talk show guest, mainly on Jimmy Kimmel Live, and The Tonight Show, emerged as the guest star on the Scrubs, contributed in humor skits on the Saturday Night Live and Kummel, and Clay Aiken has made his Broadway debut performing the character of Sir Robin in Monty Python's Spam lot in January 2008. Clay Aiken rejoined the cast as Sir Robin on September 19 and is scheduled to remain through 4th January, 2009. Clay Aiken retorted the cast as Sir Robin on 19th September and also is planned to remain throughout 4th January, 2009.

Clay Aiken formed the Bubal/Aiken Foundation in the year of 2003. Clay Aiken accepted the UNICEF ambassadorship in 2004. And in the year of 2006, Clay Aiken was selected for 2 years term through President George W. Bush to the committee that performs in a review capacity to President and the Secretary of the Department of Health and Human Services on matters relating to programs and services for persons with intellectual disabilities.

Clay Aiken unconfined the novel studio album (the opening album of unique material since 2003's Measure of A Man), permitted On My Way Here on 6th May, 2008. And this is his 4th entire length studio album, comprised a Christmas album, and an album of covers. Clay has unconfined one EP.

Activism

Clay Aiken has contributed his voice and time to manifold benefit concerts and events, comprised the 2004 Rosalyn Carter Benefit, the America's Promise Benefit, and the Heather Headley's Broadway Cares/Equity Fights AIDS benefit, "Home," where Clay Aiken sang a duet with Headley. Clay Aiken was one of celebrity readers for Arthur Celebrity Audio book, which repayments the Bubal/Aiken Foundation and additional charities, and provided as representative for the series. Clay Aiken was a representative for the 2004 Toys for Tots drive. Clay Aiken is a representative for the Ronald McDonald House Charities.

In September 2006, Clay Aiken was chosen to the Presidential Committee for Public with logical Disabilities. And the committee acts in a optional capacity to President and Secretary of the Department of Health and Human Services on topics relating to course and services for citizens with the intellectual disabilities. And appointees provide the 2 years term; Clay Aiken was confirmed in 14th September, 2006 through HHS Associate Secretary for Kids and Families Wade F. Horn, Ph.D. and in April 2008, Clay notified People Magazine that Clay was too active to do in so far as Clay Aiken would prefer, but "If there's something I can do remotely, I would've been happy to do it."

Clay Aiken Fast Facts:
  • Altered his last name from Grissom to Clay Aiken, his mother's maiden name, at the age of 20 after providing all attaches with his father.
  • Nicknamed "Gonzo" while occupying at the YMCA children's camp in Raleigh, NC.
  • Designed to trial for The Amazing Race before revolving to American Idol.
  • Was discarded at the American Idol's Charlotte, NC, trial but made it through an Atlanta, GA, audition the next weekend.
  • Hit song "The Way" was co-written by Enrique Iglesias.
  • Formed the Bubal/Aiken Foundation to assist children with neurological disabilities. The basis was named for Diane Bubel, the woman who swayed him to try-out for American Idol.
  • Penned the 2004 inspiring memoir Learning to Sing: Hearing the Music in Your Life.
Clay Aiken Relationships:
  • Deborah Grissom - Half Sister
  • Brett Parker - Half Brother
  • Catherine Aiken - Grandmother
  • Ray Parker - Stepfather
  • Faye Parker - Mother
  • Parker Foster Aiken - Son
  • Vernon Grissom - Father
  • College:
  • University of North Carolina at Charlotte, Charlotte, NC (BA in Special Education, 2003)
Discography of Clay Aiken
  • Measure of a Man (2003)
  • Merry Christmas with Love (2004)
  • A Thousand Different Ways (2006)
  • All Is Well (2006)
  • On My Way Here (2008)
Awards and nominations of Clay Aiken

Professional

American Music Awards
  1. 2003: Won - Fan's Choice Award
  2. 2003: Nominated - Favorite Male Artist - Pop or Rock
  3. Billboard Awards
  4. 2003: Won - Best Selling Single of 2003 - "Bridge Over Troubled Water/This Is The Night"
  5. 2004: Won - Best Selling Christmas Album - Merry Christmas with Love
  6. 2005: Won - Best Selling Christian Album - Merry Christmas with Love
New Music Weekly Awards
  • 2004: Won - Top 40 Male Artist of the Year
American Christian Music Awards
  • 2005: Won - Outstanding Yule CD - Merry Christmas with Love
Clay Aiken Achievements
  • 2005 Robert M. Barg Memorial Achievement Award
  • 2006 UNC Charlotte Alumni Association Outstanding Young Alumnus Award
  • 2007 National Center for Learning Disabilities' Children's Advocacy Award

Tuesday, November 25, 2008

BIRTHDAYS: Lucas Black (Birthday 29th November), Famous American Actor, Biography of Lucas Black on Career, Lucas Black Personal Life, Awards

Lucas York Black an American artist was born on 29th November, 1982 in Decatur, Alabama. Lucas Black is famous for his characters in cult CBS TV series American Gothic with the movies The Fast and the Furious: Tokyo Drift, Friday Night Lights, and Sling Blade.

Biography of Lucas Black

Without any acting lessons, Lucas Black made his movie debut with the small one part in Kevin Costner movie The War (1994) at age 11. And this small role supported him for getting good job in series "American Gothic" (1995). And when the series went to the North Carolina to direct its initial roles, the casting public in Wilmington memorized Black, and advised him for the character of “Caleb Temple”. Next time, Lucas Black was seen in sleeper-hit Sling Blade (1996) and after it Lucas Black did another dark movie Ghosts of Mississippi (1996).

A nice student, Lucas Black got the degree of graduation from the Speake High School in 2001, at where Lucas Black played golf, basketball and football. Lucas Black read fish biology, and now Lucas Black is extremely active bass fisherman. And after a little break, Lucas Black will be seen along with the Hollywood stars Natalie Portman and Jude Law in the play Cold Mountain (2003).

Lucas Black Career Graph

Without any previous training as an artist, Lucas Black’s movie debut was in 1994 Kevin Costner movie, The War. Afterward, Lucas Black was cast as the Caleb Temple in the CBS’s TV series American Gothic, which started from 1995 and 1996, and also in movies The X Files, Ghosts of Mississippi and Sling Blade. After one year in 1997, Lucas Black starred in TV movie Flash, which aired on The Wonderful World of Disney. And in 1998, Lucas Black was provided a component in The Horse Whisperer. On the other hand, when Lucas Black was stated that Black would require moderating his substantial Alabama inflection for the main part, but Lucas Black discarded the role, supposing that artists should perform mere in parts wherein they could be themselves. Throughout this period, Lucas Black also did modeling for the Calvin Klein Jeans.

Lucas Black used his spare time in modeling Calvin Klein and in sports. Lucas Black scored other summer hit with The X files (1998) and lastly Lucas Black achieved a main character in the sovereign movie Crazy in Alabama (1999). Choosy about his movie roles, Lucas Black moved towards an opportunity to star in film adaptation of The Horse Whisperer (1998) owing to the demand of having his inflection altered. And in the year of 2000, Lucas Black was seen with the Matt Damon in All the Pretty Horses (2000).

Lucas Black recent movies comprise 2004's well-appraised American football-based drama, Friday Night Lights and 2005's Gulf War-based movie, Jarhead. Lucas Black starred in leading role of 3rd film in The Fast and the Furious series, The Fast and the Furious: Tokyo Drift, contrary actor-rapper Bow Wow. And the movie released on 16th June, 2006 and grossed about $24 million. Lucas Black has depicted his character in the movie as a “fun role”.

Lucas Black Private Life

Lucas Black was the son of Larry Black, a museum employee, and Jan, an office employee. Lucas Black developed in Speake, Alabama. Lucas Black has 2 elder siblings, Lori (a sister) and Lee (a brother). Lucas Black graduated from high school in the month of May 2001.

In 2003, Lucas Black has lived in Columbia, Missouri, after completing a movie approximately 30 minutes away in Fayette.

Filmography of Lucas Black
YearTitleRoleNotesUS Box-office
2009LegionJeep Hansen  
2006The Fast andthe Furious: TokyoDriftSean Boswell $61,085,030
Killer DillerVernonlimited release 
2005DeepwaterNat Banyon  
2005JarheadKruger $62,658,220
2004Friday NightLightsMike Winchell $61,255,921
2003Cold MountainOakley $95,636,509
2000All thePretty HorsesJimmy Blevins $15,540,353
The MiracleWorkerJames KellerTV version 
1999Crazy in AlabamaPeter Joseph 'Peejoe' Bullis $2,005,840
1998The X FilesStevie $83,898,313
1997FlashConnormade-for-television 
1996Ghosts of MississippiBurt DeLaughter $13,323,144
Sling BladeFrank Wheatley $24,444,121


Awards of Lucas Black
YearGroupAwardWon?FilmNotes
1997Saturn AwardBest Performance by a Younger ActorYesSling Blade 
ChlotrurdisAwardBest Supporting ActorNo 
The ActorOutstanding Performance by a CastNoShared withBilly Bob Thornton, Dwight Yoakum, J. T. Walsh, John Ritter, Natalie Canerday and Robert Duvall
Young ArtistAwardBest Performance in a Feature Film - Leading Young ActorYes 
Young Star AwardBest Performance by a Young Actor in a Drama FilmYes 
Best Performance by a Young Actor in a Drama TV SeriesNoAmericanGothic 
1998Young ArtistAwardBest Performance in a TV Movie/Pilot/Mini-Series - LeadingYoung ActorNoFlash 
2000Sierra AwardYouth in FilmNoAll thePretty Horses 
Young ArtistAwardBest Performance in a Feature Film - Leading Young ActorNoCrazy in Alabama 
Young Star AwardBest Young Actor/Performance in a Motion Picture DramaNo 
2001Young ArtistAwardBest Performance in a Feature Film - Supporting YoungActorNoAll thePretty Horses 
2006Teen ChoiceAwardMovies - Choice Breakout (Male)NoThe Fast andthe Furious: TokyoDrift 

BIRTHDAYS: Tina Turner (Birthday 26th November), Famous American Actress & Pop Singer, Biography of Tina Turner on Career, Personal Life & Awards

Tina Turner, an American actress and pop singer, who was considered one of the leading comebacks in the recording history. Tina Turner was born on 26th November, 1939 in Nutbush, Tennessee, United States

Biography of Tina Turner

Tina Turner Background:

“I will never give in to old age until I become old. And I’m not old yet.” Tina Turner

entering the melody scene as a singer of Ike and Tina Turner Revue, seven-times Grammy conqueror Tina Turner was broadly commended for the single “What’s Love Got to Do with It” (1984, succeeded 3 Grammy Awards), which afterward became the label of 1993 film based on her memoirs “I, Tina” (1986). And the vocalist, who is popular for her raspy voice, big hair and her long legs, scooped up the Grammy Awards for singles “Better Be Good To Me” (1985), “One of the Living” (1985, single of 1985’s Mad Max Beyond Thunder dome) and “Back Where You Started” (1986), with for the album Tina Live in Europe (1988).

Tina Turner, who was pleased with 1993 World Music’s Exceptional Contribution to the Music Award and 1999 MOBO Lifetime Achievement Award, also attempted acting. After various small stints, an artist landed the female main role in the Mad Max Beyond Thunder dome and took residence an Image Award.

Back stage, Tina Turner achieved a Star on the Hollywood Walk of Fame in the year of 1986. Tina Turner became the second one performer of “VH1’s Greatest Women of Rock N Roll,” an inductee of the Rock and Roll Hall of Fame (with Ike Turner) in 1991, and the 6th personality of VH1’s “100 Sexiest Artists.” And in approval for her creative commitment, Tina Turner won a Kennedy Center Honors in 2005.

Tina Turner, once who had the reconstructive nose surgery because of her ex-husband’s regular beating, commenced practicing Buddhism in 1975. Tina was wedded with Ike Turner. They had a son. He oppressed and abused her. At present, Tina Turner lives with the EMI record administrative Erwin Bach in Zurich, Switzerland.

Tina Turner Childhood and Family:

Tina Turner was born on 26th November, 1939, in Nut bush, Tennessee. Tina Turner mother is Afro-American and her father is Native American.

Tina Turner met Ike Turner, a celebrated pioneer of rock n roll, and attached with his band, “The King of Rhythm. And at the age of 18, Tina Turner launched her proficient career as a singer under the stage name “Tina Turner.” Within few years, Tina Turner became the focus of the band’s soul sound.

In 1958, Tina Turner gave birth a son from her attachment with Raymond Hill, Saxophone performer in the Kings of Rhythm. And in the year of 1962, they wedded with Ike and they had a son named Ronnie. Tina Turner has 2 stepsons, Michael and Ike Jr., from the previous marriage of Ike. On the other hand, owing to Ike’s invariable bodily abuse and suspected drug use, and they separated on 29th March, 1978.

One of the Living

Tina Turner Career Graph:

following numerous stage gigs, Tina Turner and the Kings of Rhythm instantly burned up the pop charts and R&B with the solo “A Fool in Love” (1960). After it, they obtained higher status through their striking live performances and appealing singles. Though they failed to amaze viewers with “River Deep – Mountain High” (1966), and the Turner Revue raised to renown with the wrap of Credence Clearwater Revival’s hit, “Proud Mary” (1971).

Tina Turner did the small role of a visitor at Heartland in musical family movie Sgt. Pepper’s Lonely Hearts Club Band (1978). On the tour show, Ike Turner abused her and then Tina left the band.

Owing to Tina Turner official debit to the tour advertiser and her requirement to make the living, Tina Turner went to the screen and formed an episodic performance in these shows as “The Brady Bunch Hour” (1977), a 1978 episode of “Musicales” (1978) and a 1979 episode of “The Midnight Special.” Tina Turner performed in the television program Olivia Newton-John: Hollywood Nights (1980) and Rod Stewart: Tonight He’s Yours (1981), in addition to made live performances in US and UK.

Tina Turner launched a single album Private Dancer (1984); Tina Turner was a smack as a vocalist. The album began with three Top Ten singles, “Better Be Good To Me”, “What’s Love Got to Do with It,” and the titular track (released in 1985). Moreover, the smack single “What’s Love Got to Do with It” gathered up 3 Grammies (one for Song Of The Year, one for Record Of The Year, and also one for Best Female Pop Vocal Performance), whereas “Better Be Good To Me” contributed the Grammy (for the Best Female Rock Vocal Performance) to the album.

In 1993, Tina Turner achieved the Grammy for Tina Live in Europe (1988) and unconfined a ostensible album for a film What’s Love Got to Do with It (1993), and it was based on her life story.

The receiver of 1993 World Music’s Outstanding Contribution to the Music Award concerned the anthology album The Collected Recordings - Sixties to Nineties, in 1994. Afterward Tina Turner performed the ostensible theme of James Bond movie Golden eye (1995). Her theme song presentation in “He Lives In You,” for Disney’s active feature The Lion King II: Samba’s Pride (1998), directed to the discharge of her platinum album Twenty Four Seven, in 1999.

In the year of 1999, Tina Turner achieved the MOBO Lifetime Achievement Award and presented in the VH1’s Divas Live ’99, with numerous major artists like Elton John, Whitney Houston, and Cher. Progressively taking out the melody scene, the vocalist recorded “Great Spirits” for Disney’s Brother Bear (2003) and unconfined the biggest hits collection All the Best (2004).

Tina Turner obtained international appreciation; Tina Turner topped the Italian single charts with her duo with a performer Elisa in “Teach Me Again” (2006), from the single of All the Invisible Children (2005). Apparently, the expert singer is at present working on the novel album.

Awards of Tina Turner:
  • Grammy: Song Of The Year, “What’s Love Got to Do With It,” 1985
  • Grammy: Best Female Rock Vocal Performance, “Better Be Good To Me,” 1985
  • Grammy: Record Of The Year, “What’s Love Got to Do With It,” 1985
  • Grammy: Best Female Pop Vocal Performance, “What’s Love Got to Do With It,” 1985
  • Grammy: Best Rock Vocal Performance, “One of the Living,” 1986
  • Image: Outstanding Lead Actress in a Motion Picture, Mad Max Beyond Thunder dome, 1986
  • Grammy: Best Female Rock Vocal Performance, “Back Where You Started,” 1987
  • Grammy: Best Female Rock Vocal Performance, Tina Live in Europe, 1989
  • World Music: Outstanding Contribution to Music Award, 1993
  • MOBO (Music of Black Origin): Lifetime Achievement Award, 1999

BIRTHDAYS: Trey Songz (Birthday 28th November), Famous American Singer, Biography of Trey Songz on Career, Personal Life & Trey Songz Achievements

Trey Songz an American mod R&B songwriter and singer was born on 28th November, 1984 in Petersburg, Virginia.

Biography of Trey Songz

As a child, Trey Songz has no piano lessons and rigorous voice. In fact, during high school, Trey Songz was trying what most children of his time were doing: throwing parties, playing basketball and getting pulled to church through his pious grandmother, who sang in the gospel chorus. “I wasn’t even paying attention to R&B at the time,” states Trey. “I was listening to straight rap, like Biggie, Jay-Z, and Nas.” And the mere R&B artist who seized his notice was R. Kelly, whose job Trey Songz reverses. “When it comes to R&B, he kills it. Trey Songz gives you every part of the soul he can think of, from the gangsta to the gentleman,” states Trey Songz, whose flexible tenors invoke a younger Kelly.

At the command of his mother and colleagues, Trey Songz entered, and achieved, about 20 local endowment shows. Trey Songz was swiftly making a name for himself. While the genuine epiphany did not arise until the age of 15, when Trey Songz met his mentor and producer, Troy Taylor- an experienced person whose recommence comprises everyone from the Patti Labelle to SWV, Lionel Ritchie to B2K. Astonished through a cappella edition of “All The Things I Do,” a song Trey Songz himself had composed, Taylor advised him to beaf solemn.

After completing his school days, Trey Songz shifted to New Jersey to center solely on melody. Taylor, sequentially, centered on teaching his responsibility in music record. “We would go to the New York studio every day, and during the drive, he’d play me all sorts of stuff, like Steely Dan,” evokes Trey. “When it came time to learn about falsetto, he’d play me Prince. When it came time to learn about soul, he’d play me Motown.” Trey Songz ultimately became his vocal production supporter. Working with additional performers in studio gave him invaluable technological experience, and made the young vocalist for his dazzling future.

Trey Songz Career Graph

Call it R&B with the hip-hop exigency. “We’re just Call it R&B with a hip-hop urgency. “We’re just making sure that I’m felt in the streets as much as I’m felt on the soulful level,” states 20 years old Atlantic recording artist and songwriter Trey Songz.

Trey Songz unveiling album was Gotta Make It, unconfined through Atlantic Records in 2005. It motivated musically through R&B performers from 1960s and 1970s for instance Aretha Franklin and Smokey Robinson with contemporary performers such as R. Kelly and Luther Van dross, the young star debuted in the year of 2005.

Trey Songz rapidly growing ability led to Atlantic Records. R&B history formed it the ultimate home for his exclusive blend of contemporary and the classic. “I believe that Trey Songz is among the most promising R&B artists we have had on Atlantic since we started the company nearly sixty years ago,” stated Atlantic Founding Chairman Ahmet Ertegun. “It has been our privilege to record such legendary performers as Ray Charles, Aretha Franklin, and Otis Redding, and I believe that Trey is poised to be the heir of our great R&B legacy. He has the voice, the songs, the intelligence, the soul, and the charisma of a true star.”

Whereas running on his unveiling album, Trey Songz has got overloaded work on the outside projects. Trey Songz has co-produced and written for Kevin Lytle’s self-titled presentation; sang solo on from Coach Carter: Music From The Motion Picture, “About The Game,” is attributed on “Ain’t A Thug,” on Trick Daddy’s newest album, Thug Matrimony; and sings backing on Gerald Leveret’s “What Happened To The Lovin’” on his newest collection. Trey Songz co-wrote on the couple of tracks scheduled for the Juvenile’s forthcoming album. Besides, Trey Songz is on spout to team up with preferences of Snoop Dogg, Trina and Lil’ Kim on their upcoming projects.

Most prominently, Trey Songz has been full of activity faultless his own expressive premier, I Gotta Make It, an 11-entry diary about a boy and his charming dreams, hustles and loves – an occupation of street and lovable sensibility formed mostly through Troy Taylor. And from the inspiring first single (“Gotta Make It,” featuring Twista), to awareness that possibly you’re in love with the wrong person (“Cheat On You”), to the statement that there’s nobody in the globe for you (“Let’s Make Love Tonight”), and the album has rather for everybody. The album I Gotta Make It features production from the Organized Noise (“Coming For You”) and also Warren Campbell (“Ooo”).

Simultaneously, Trey Songz’s modify ego, the “Prince of Virginia,” is upholding his lane cred by forcefully attacking the mix tape track. This route, generally used through rap performers, has formed this R&B songwriter/singer a stick out in the middle of his peers. Through mixing out mix tape signals like “You Can Get It” featuring T.I, “Ghetto People” and “Dreams Freestyle”- his own turn on The Game’s “Dreams” and R. Kelly’s Happy People”- Trey Songz has street pleading for more. “There’s so much on my mind that I can’t say on a regular R&B record,” admits Trey. “So mix tapes are a great outlet to sing about some wild, crazy, stuff.”

Discography of Trey Songz

Albums
• I Gotta Make It
  • Released: 26th July, 2005
  • Label: Songbook Ent./Atlantic Records
  • RIAA Certification: N/A
  • Chart Positions: #20 U.S.
  • U.S. Sales: 300,000
  • Singles: "Gotta Make It", "Gotta Go"
• Trey Day
  • Released: 2nd October, 2007
  • Label: Songbook Ent./Atlantic Records
  • RIAA Certification: N/A
  • Chart Positions: #11 U.S.
  • Singles: "Wonder Woman", "Last Night"
  • U.S. Sales: 350,000
Singles

Trey Songz Solo singles
YearSongU.S. Hot 100U.S. R&BAlbum
2005"Gotta MakeIt" (featuring Twista)8721I Gotta MakeIt
"Gotta Go"6711
2007"WonderWoman"54Trey Day
"Can't Helpbut Wait"142
2008"LastTime"699
"Missin'You"
2008"In Ya Phone" (featuring Fabolous)READY
"Together"(featuring Christina Milian)

Featured singles of Trey Songz
YearSongU.S. Hot 100U.S. R&BAlbum
2004"Ain't a Thug" (Trick Daddy featuring TreySongz)ThugMatrimony
2005"Summer wit Miami"(JimJones featuring Trey Songz)76Harlem: Diary of a Summer
"GirlTonite" (Twista featuring Trey Songz)143The Day After
2006"1st Time [Remix]"(YungJoc featuring Marques Houston & Trey Songz)8215New Joc City
2007"Pain in My Life" (Saigon featuring Trey Songz)91The GreatestStory Never Told
"Replacement Girl" (Drake featuring Trey Songz)Comeback Season
"¿QuienEres Tú?" (Maria Jose featuring Trey Songz)Maria Jose
"Girl YouKnow" (Scar face featuring Trey Songz)51Made
2008"Da Baddest" (Big Kuntry King featuring TreySongz)101My Turn toEat
"Cutty Buddy" (MikeJones featuring Trey Songz, Lil Wayne, & Twista)7634Voice of theStreets
"Ride" (Ace Hood featuring Trey Songz)12132Gutta

BIRTHDAYS: Twista (Birthday 27th November), Famous American Rapper, Biography of Twista on Career, Personal Life & Twista Achievements, Discography

Twista Born: 11.27.1973
Twista Birth Name: Cavalier Terrell Mitchell
Label: Get Money Gang
Genre: Hip hop, gangsta hip hop, Rap Metal, hardcore hip hop, Midwest hip hop
Alias: Tung, Twista, King, Of, the, Chi
Representin': Chicago, Illinois

Carl Terrell Mitchell an American Rapper was born on 27th November, 1973 in Chicago, Illinois. Carl Terrell Mitchell is popular through his stage name Twista. His 2004 single album Kamikaze went to No.1 on U.S. Billboard 200 albums chart following the achievement of his number 1 on Billboard Hot 100 single, “Slow Jamz”.

Biography of Twista

Twista developed in K-Town district on the west side of Chicago. When Twista was 12 years old, Twista began rapping. Though, before beginning his proficient career, Twista worked at some additional jobs comprised working at selling shoes, working as a security guard, working at McDonald’s, cutting hair and working at a factory.

Twista Music Career

Twista was considered the foremost artist to mark with the Loud Records. And in the year of 1991, Twista unconfined Runnin’ off at da Mouth below the name of Tung Twista. Owing to his rapid-fire swiftness of delivery, Twista was counted in Guinness Book of Records as world’s speedy rapper. In spite of his recognition, the album obtained little success. Twista dropped “Tung” off of his name in his IInd album Resurrection. It was never discharge exterior of Chicago’s antiestablishment.

In the year of 1996, Twista teamed with colleague Chicago act “Do or Die” on track “Po’ Pimp” directing to the contract with the Atlantic Records. Twista unconfined the Adrenaline Rush in 1997 followed through Mob solidity in the year of 1998. Then Twista shaped his own Legit Ballin’ label which has unconfined two collection albums Legit Ballin’ in 1999 and other Legit Ballin’ Vol. 2: Street Scriptures in 2001. Later the label unconfined Respect The Game, Vol. 3 in 2002 and Volume 4: Tha Truth in 2006. And in the year of 2000, Twista teamed up with Drag-On and Ruff Ryders on the Ruff Ryders: Ryde or Die Vol. 2 albums, on the track "Twisted Heat."

In 2002, Twista started recording in his album Kamikaze with the rappers like Ludacris and Jay-Z. Kamikaze released in the 2004 and unveiled at the apex spot of American Billboard 200 album chart; and its first single "Slow Jamz" featured West and also Jamie Foxx and it became the number-one hit in US. And other singles comprised “So Sexy” and “Overnight Celebrity”; the album sold out about 2 million copies.

And the remix song “Jook Gal” through Elephant Man attributed Twista and Young Blood Z. and his next album, The Day After, was unconfined in 2005. it featured the smack singles "Girl Tonite" featuring Trey Songz, "Hit the Floor" attributing Pit-bull, and "One and Only" featuring Mariah Carey. And his other album, Adrenaline Rush 2007, released in 2007 with the singles "Give it Up" featuring Pharrell and "Creep Fast" featuring T-Pain. And this album was badly received through most of Twista fans.

Twista emerged on the single "Hell No (Leave Home)" from Monica's album The Makings of Me. And in the year of 2008, Twista launched the latest record label, Get Money Gang.

Discography of Twista
Twista Solo albums
  • 1992: Runnin' Off at da Mouth
  • 1994: Resurrection
  • 1997: Adrenaline Rush
  • 2004: Kamikaze
  • 2005: 2 For 10
  • 2005: The Day After
  • 2007: Adrenaline Rush 2007
Albums with Speed knot Mobstaz
  • 1998: Mob stability
  • 2008: Mob stability II: Nation Business
  • Before exploding the music, Twista had many other works to make money...such as working at McDonald's, working at a Factory, cutting hair, working as a security guard and even selling shoes.
  • Twista was the earliest artist signed to the Loud Records.
  • In 2005 the game Midnight Club 3: DUB Edition was unconfined and three of Twista's songs emerged on it these were "Sunshine", which featured the Anthony Hamilton; "Like A 24", which featured T.I. & Liffy Stokes; and "Overnight Celebrity", which features and was formed through Kanye West.
  • "Hope" was initially on Twista's album Kamikaze, but was never unconfined as a single until it emerged on soundtrack to the movie Coach Carter. The Kamikaze edition featured Cee-Lo, while the Coach Carter version had Faith Evans.
  • Twista has given three Making The Video episodes to date: "Hope" feat. Faith Evans, "Hit The Floor" feat. Pit-bull, and The Notorious B.I.G.'s "Spit Your Game (Remix)" video
  • Twista began a Detroit vs. Chicago Beef over Do or Die's "Po Pimp" (1996) and Esham's Natas group "We Almost Lost Detroit" (1995) (due to the same beat that faded out around the late 90's.)
  • Japanese pro wrestler KENTA uses the remix of "Art & Life" as his theme song.
  • Has his own column in the weekly Chicago Tribune publication, Redeye, called "Twista's Turn" where Twista shares his views and answers readers' questions?
  • Twista also made the track with Rapper * Mr. Capone-E with the single "Don't Get it Twisted" created by Fingazz
  • Twista has emerged on the remix of Sting's "Stolen Car (Take Me Dancing)", and has emerged on Dancing With the Stars.
  • Twista is left-handed.
  • Twista gave many tracks to Midway's L.A. Rush video game, with providing his tone.
  • In video for "Sunshine", at 1:37-1:38 there is a shot of Kermit the Frog dancing in the background.
  • Twista is alleged to be 4 Corner Hustler from K-Town in West Side Chicago.

Saturday, November 22, 2008

BIRTHDAYS: Christina Applegate (Birthday 25th November), Famous American Actress, Biography of Christina Applegate on Career, Personal Life, Awards

Christina Applegate an Emmy Award-winning American artist was born on 25th November, 1971 in Hollywood, California. Christina Applegate is famous for playing the Kelly Bundy on long-running FOX Broadcasting Company sitcom Married… with Children. Christina Applegate has established a movie and TV career, with main roles in various pictures, for instance The Sweetest Thing, Anchorman, and Farce of the Penguins. Christina Applegate has starred in various productions comprised 2005 Broadway revitalization of the melodious Sweet Charity. Currently, Christina Applegate plays the main role, Samantha Newly, in ABC sitcom Samantha Who?.

Biography of Christina Applegate

Christina Applegate Early Life

Christina Applegate was the daughter of Robert W. Applegate, a record producer and record company executive and Nancy Lee Priddy was an actress and a singer. Christina Applegate parents separated in her childhood.

Christina Applegate Career Graph

Christina Applegate made her television debut, emerging with her mother in soap Days of our Lives and afterward, at the age of 5, in a viable for Playtex. At the age of 9, Christina Applegate gave her best performance on the big screen. Christina was seen in 1981 movies Jaws of Satan and Beatle mania. Christina Applegate debuted in television film as the young Grace Kelly in the biopic Grace Kelly. Christina Applegate emerged on her initial television series in Showtime's biased comedy Washington (1985), in which Christina played the role of a Congressman's daughter. Christina Applegate was marked as a visitor in shows Father Murphy (1981) and Charles in Charge (1984 and 1985).

In the year of 1986, Christina Applegate won the character of Robin Kennedy (1986-1987), a cop's daughter, on a police drama series Heart of the City. In the mean time, Christina Applegate was seen guest starring in sitcoms Family Ties, All is Forgiven, Amazing Stories, and Still the Beaver event Band on the Run (1987) as Kitten.

While functioning on the series, Christina Applegate was seen in Dance 'Til Dawn (1988, NBC) and in Streets (1990), in which a young drug addict is followed through a psychotic police officer. Christina Applegate guest-starred in the 21 Jump Street (1988), Top of the Heap 1991, and hosted Saturday Night Live (May 8, 1993) and Mad TV (1996).

Christina Applegate did her first starring role of Sue Ellen Crandall in a comic film Don't Tell Mom the Babysitter's Dead (1991). Christina Applegate followed it up with movies such as Wild Bill - 1995, Across the Moon -1995, Vibrations - 1995, Mars Attacks! - 1996, and Nowhere - 1997.

At the same year, NBC handed her the main role in the sitcom Jesse. This series released in 1998, it got rave reviews and it brought Christina a People's Choice Award for the Favorite Female Artist in the New Television series and TV Guide Award for Star of a New Series with a recommendation at Golden Globe for Front Actress in humor. While the series achieved admiration but it was disregarded in 2000.

"This was a major commitment. I really had to sit and think about it. I eventually came to the conclusion that it came into my life for a reason." - Christina Applegate (on allowing her job in sitcom Jesse).

After obtaining wide note for playing the Cameron Diaz's level-headed best friend, Courtney Rockcliffe , in The Sweetest Thing (2002), Christina Applegate kept on to win characters in such films as Heroes (2002), Grand Theft Parsons (2003), Wonderland (2003), View from the Top (2003), Employee of the Month (2004), and Surviving Christmas (2004). Behind the television, Christina was the administrative maker of Comforters, Miserable (2001).

Christina Applegate Later Career

Christina Applegate guest-starred on the two series of Friends, in 9th (2002) and 10th (2003) seasons, named "The One Where Rachel's Sister Baby sits" and "The One with Rachel's Other Sister" as Amy Green, Rachel's (Jennifer Aniston) younger sister. Christina Applegate won 55th Annual Prime Time Emmy Award for Best Guest Actress in jesting for her presentation in "The One with Rachel's Other Sister". And on silver screen, Christina depicted television anchorwoman Veronica Corning stone in 2004 movies Anchorman: The Legend of Ron Burgundy and DVD bonus movie Wake Up, Ron Burgundy: The Lost Movie.

Besides her television work, Christina Applegate has performed on the stage in these productions as The Run through, Nobody Leaves Empty Handed, The Axe man’s Jazz, with John Cassavetes' The Third Day (co-starring Gena Rowland). And in the year of 2004, Christina Applegate debuted on Broadway stage performing the main role of Charity Hope Valentine in the recovery of 1966 musical Sweet Charity. Eventually Christina Applegate took home the 2005 Theatre World Award and was chosen for 2005 Tony Award for Best Actress in a Musical.

In 2006, Christina Applegate emerged in Jessica Simpson's melody video "A Public Affair", along with Christina Milian, Ryan Sea crest and Eva Longoria.

At present, Christina Applegate is starring in ABC jesting, Samantha Who? And also co-starring with Melissa McCarthy, Jennifer Esposito, and Jean Smart.

And in 2003, Christina Applegate was the representative for Lee National Denim Day, which lifts millions of dollars for breast cancer edification and research.

Christina Applegate was revealed in the famous song by P.M. Dawn named "Set Adrift on Memory Bliss". And the line, "Christina Applegate, you Gotta put me on" is a mention to a song "Bonita Apple bum" through A Tribe Called Quest.

Christina Applegate Current Career

Christina Applegate will play the role of Beth Montgomery, who expired colorectal cancer, in the forthcoming film Everything Is Going to Be Just Fine, owing to be released in 2009.

Christina Applegate Personal Life

In October 2001, Christina Applegate e wedded with the best friend Jonathon Schaech. In November 2005, they separated with each other.

On 1st July, 2008, her best friend and ex-boyfriend Lee Grivas was found lifeless of an evident drug overdose.

Breast cancer

On 3rd August, 2008, People Magazine gave a statement that Christina Applegate had been detected with breast cancer. And this was verified by her spokesperson, who stated in a report: "Christina Applegate was diagnosed with an early form of breast cancer. Benefiting from early detection through a doctor ordered MRI; the cancer is not life threatening... Christina is following the recommended treatment of her doctors and will have a full recovery. No further statement will be issued at this time"

Filmography of Christina Applegate
  • 1981 Jaws of Satan
  • 1981 Beatle mania
  • 1986 Heart of the City as Robin Kennedy
  • 1987 Married With Children as Kelly Bundy
  • 1988 Dance 'Til Dawn as Patrice Johnson
  • 1990 Streets
  • 1991 Don't Tell Mom the Babysitter's Dead as Sue Ellen Crandell
  • 1995 Wild Bill
  • 1995 Vibrations
  • 1995 Across the Moon
  • 1996 Mars Attacks!
  • 1997 Nowhere
  • 1998 The Big Hit
  • 1998 Jane Austen's Mafia!
  • 1998 Jesse as Jesse Warner
  • 1998 Claudine's Return as Claudine Van Doozen
  • 1999 The Brutal Truth
  • 1999 Out in Fifty as Lilah
  • 2000 American Psycho as Prostitute
  • 2000 The Giving Tree
  • 2001 Prince Charming
  • 2001 Sol Goode
  • 2001 Just Visiting as Princess Rosalind/Julia Malfete
  • 2002 Heroes
  • 2002 The Sweetest Thing as Courtney Rockcliffe
  • 2003 Wonderland as Susan Launius
  • 2003 Grand Theft Parsons
  • 2003 View from the Top as Christine Montgomery
  • 2004 Anchorman: The Legend of Ron Burgundy as Veronica Corningstone
  • 2004 Surviving Christmas as Alicia Valco
  • 2004 Employee of the Month as Sara Goodwin
  • 2005 Suzanne's Diary for Nicholas as Natalie Cook
  • 2005 Tilt-A-Whirl
  • 2007-present Samantha Who? as Samantha
  • 2007 Farce of the Penguins as Melissa (voice)
  • 2008 The Rocker as Amanda Wood
  • 2009 Everything Is Going to Be Just Fine as Elizabeth Montgomery
Television
  • 2007 Tony Awards - Presenter, June 10, 2007
  • 2007 American Music Awards - Presenter, November 18, 2007
  • 2005 Tony Awards - Presenter, June 5, 2005
  • 2003 - 2004 Friends - Amy Green
  • Family Ties - Uncredited appearance as one of Tina Yothers's friends
  • King of the Hill
  • Silver Spoons
  • 1997 Mad TV
  • 2008 Reno 911!

BIRTHDAYS: Katherine Heigl (Birthday 24rd November), Famous American Actress, Biography of Katherine Heigl on Career, Personal Life, Awards

Katherine Marie Heigl an Emmy Award-winning American actress was born on 24th November, 1978 in Washington, D.C. Katherine Heigl is popular for her characters in Knocked Up, 27 Dresses, Grey's Anatomy, and Roswell.

Biography of Katherine Heigl

Katherine Heigl Early Life

Katherine Heigl was the daughter of Paul Heigl, a monetary accountant and Nancy, a private manager. Katherine Heigl has Irish and German ancestry. Katherine Heigl was raised as an opponent of The Church of Jesus Christ of Latter-day Saints. Katherine Heigl is the youngest child in four children. Katherine Heigl lived in Virginia and after it Katherine Heigl shifted to Connecticut with her family.

In 1986, Katherine Heigl brother Jason expired because of car accident. And after his death, all they decided to contribute his organs. And subsequently, their parents transformed to The Church of Jesus Christ of Latter Day Saints. Now Katherine Heigl is a strong supporter of organ endowment. While Katherine is no longer a working Mormon and Katherine Heigl remains optimistic on various aspects of religion. Katherine Heigl has uttered interest in coming back to her trust.

Katherine Heigl Career Graph

Katherine Heigl began modeling and ultimately emerged in television commercials. And in the year of 1992 Katherine Heigl made her film debut in That Night and slight roles in the series of movies followed. In the year of 1995, Katherine Heigl starred in Steven Seagal action detective movie Under Siege 2: Dark Territory. After completing her degree, Katherine Heigl shifted to Los Angeles to follow an acting career. In 1996, Katherine Heigl parents divorced and her mother was detected with cancer. Quickly Katherine found her regular work, comprised the wit fantasy Wish upon a Star (1996) and other horrible movie Bride of Chucky (1998). In the year of 1998, Katherine co-starred with Peter Fonda in re-working of the typical Shakespearian play The Tempest, set in the American Civil War. After it, Katherine Heigl starred the awful film Bride of Chucky.

And in the year of 1999 Katherine Heigl performed a character in science-fiction television series Roswell. It became hit and Katherine Heigl acquired much awareness as Alien Isabel. And after completing Roswell in 2002, Katherine Heigl starred in lots of television films, comprised Love Comes Softly (2003) and a follow-up, Love’s Enduring Promise (2004). In the year of 2003, Katherine Heigl emerged in three television films. Katherine came back to horror genre with the Evil Never Dies, a current distinction on Frankenstein story co-starring with Thomas Gibson. And Love Comes Softly, for the Hallmark amusement, found Katherine Heigl starring as Marty Coleridge, a juvenile, pregnant newlywed roaming west. Katherine Heigl played Isabella Linton in MTV's recent revamp of the Bronte’s Wuthering Heights. And in October 2003, Katherine Heigl was directed contrary to Johnny Knoxville in The Ringer, a Farrelly brothers humor that was unconfined in December 2005. Katherine Heigl starred as a Romy in 2005 television fi
lm Romy and Michele: in the Beginning, prequel to 1997 movie Romy and Michele's High School Reunion. And in the year of 2005, Katherine Heigl starred in low budget terror flick Zyzzyx Road.

And in the year of 2005, Katherine Heigl got big break when Katherine was directed in Grey’s Anatomy, a dreamed about the hospital doctors. And this show became hit and formed Katherine Heigl a star. In the year of 2007, Katherine Heigl achieved her primary Emmy award, for the best supporting actress. And that year, Katherine Heigl made news and when Katherine publicly criticized costar Isaiah Washington.

In 2008, Katherine Heigl depicted about Dr. Isobel Stevens on hit TV series Grey’s Anatomy. Katherine Heigl e seemed the novel queen of passionate comedies on big screen. Afterwards on the vast success of Knocked Up (2007), Katherine Heigl starred same as the serial bridesmaid In search of Mr. Right in 27 dresses. And the cheerful movie grossed approximately $160 million all-inclusive. And off-screen, the candid Katherine Heigl always found herself at focus of the drama. And in the month of June, Katherine Heigl angered producers and writers of Grey’s Anatomy when Katherine Heigl declared that Katherine Heigl had detached herself from deliberation for Emmy, stating that Katherine had not given substance to justify a recommendation.

While emerging on the Grey’s Anatomy, Katherine Heigl continued to have a film career. When Katherine Heigl’s role becomes pregnant and made a decision to keep the child, the improbable couple tries to form a life-long relationship. In spite of her claim that the movie was the “little sexiest,” it was a commercial and critical success, grossing approximately $220 million all inclusive. Katherine Heigl looked to produce more laughs in the year of 2009, when The Ugly Truth was planned to be released.

Katherine Heigl Private Life

Katherine Heigl had a relationship with Roswell costar Jason Behr. And they separated when the series finished. And in June 2006, Katherine Heigl engaged with a singer Josh Kelley. They met on the place of his melody video for "Only You." And they wedded on 23rd December, 2007 in Park City, Utah. And in December, 2007, Katherine Heigl and Kelley shifted to a new-fangled home in Los Feliz, California. And in late 2007, Barbara Walters named Katherine Heigl one of "The 11 Most Fascinating People of 2007” on ABC program of that label. Katherine questioned about her enclosure on the list, stating that Katherine is really "quite boring.....not, just kidding, but really".

Filmography of Katherine Heigl
YearTitleRoleNotes
1992That NightKathryn 
1993King of the HillChristina Sebastian 
1994My Father the HeroNicole 
1995Under Siege 2: Dark TerritorySarah Ryback 
1996Wish Upon a StarAlexia Wheatonmade-for-television
1997Prince ValiantPrincess Ilene 
Stand-insTaffy-Rita Hayworth's Stand-in 
1998Bug BusterShannon Griffin 
Bride of ChuckyJade 
The TempestMiranda Prospermade-for-television
1999RoswellIsabel Evans1999-2002
2000100 GirlsArlene 
2001ValentineShelley Fisher 
2003Love Comes SoftlyMarty Claridgemade-for-television
Wuthering HeightsIsabel Lintonmade-for-television
Evil Never DiesEvemade-for-television
Critical AssemblyAizy Hayward 
2004Love's Enduring PromiseMarty Claridge Davismade-for-television
2005Romy and Michele: In the BeginningRomy Whitemade-for-television
Side EffectsKarly Hert 
The RingerLynn Sheridan 
Grey's AnatomyDr. Isobel "Izzie" Stevens2005-present
2006Zyzzyx RoadMarissaThe film only made $30 (not million) in box office
CaffeineLaura
2007Knocked UpAlison ScottSalary: $300,000 USD
200827 DressesJane NicholsMajor Role Salary: $6 million USD
2009The Ugly TruthAbby Richterin post-production



Friday, November 21, 2008

EVENTS: Martin Luther King Jr. Day Date, Martin Luther King Day 2009, US National Holiday, Martin Luther King Jr. Day Date Calendar, 2010, 2011, Dates

Martin Luther King Jr. Day is National Holiday.

Monday, Jan 17, 2005 - Martin Luther King Jr. Day
Monday, Jan 16, 2006 - Martin Luther King Jr. Day
Monday, Jan 15, 2007 - Martin Luther King Jr. Day
Monday, Jan 21, 2008 - Martin Luther King Jr. Day
Monday, Jan 19, 2009 - Martin Luther King Jr. Day
Monday, Jan 18, 2010 - Martin Luther King Jr. Day
Monday, Jan 17, 2011 - Martin Luther King Jr. Day
Monday, Jan 16, 2012 - Martin Luther King Jr. Day
Monday, Jan 21, 2013 - Martin Luther King Jr. Day
Monday, Jan 20, 2014 - Martin Luther King Jr. Day
Monday, Jan 19, 2015 - Martin Luther King Jr. Day
Monday, Jan 18, 2016 - Martin Luther King Jr. Day
Monday, Jan 16, 2017 - Martin Luther King Jr. Day
Monday, Jan 15, 2018 - Martin Luther King Jr. Day
Monday, Jan 21, 2019 - Martin Luther King Jr. Day
Monday, Jan 20, 2020 - Martin Luther King Jr. Day

Thursday, November 20, 2008

BIRTHDAYS: Mark Ruffalo (Birthday 22nd November), Famous American Actor, Biography of Mark Ruffalo on Career, Mark Ruffalo Personal Life, Achievement

Mark Alan Ruffalo an American artist was born on 22nd November, 1967 Kenosha, Wisconsin.

Biography of Mark Ruffalo

Mark Ruffalo Early Life

Mark Ruffalo was the son of Frank Lawrence Ruffalo, Jr., a creation painter and Marie Rose, stylist and hairdresser. Mark Ruffalo has 2 sisters, Nicole and Tania and Brother Scott. Mark Ruffalo has depicted himself as "happy kid". Mark Ruffalo attended the Progressive school. Mark Ruffalo passed his teen age in Virginia Beach, Virginia, at where his father Frank Lawrence worked. Mark Ruffalo got the degree of graduation from the First Colonial High School. Then Mark Ruffalo moved with his family to San Diego, California and after it Mark Ruffalo shifted to Los Angeles, California. Mark Ruffalo took the classes at Stella Adler Conservatory and co-found the Orpheus Theatre Company. And with OTC, Mark Ruffalo starred, wrote and directed in several plays and passed the next 9 years earning his livelihood as bartender.

Mark Ruffalo Career Graph

Mark Ruffalo had slight roles in movie like The Dentist (1996), modest crime comedy Safe Men (1998) and Ang Lee's applauded Civil War Western Ride with the Devil (1999). Through an opportunity meeting with the striper Kenneth Lonergan, Mark Ruffalo began collaborating with Lonergan. Mark Ruffalo emerged in lots of his dramas, comprised the unique cast of This Is Our Youth (1998). Mark Ruffalo received approving reviews for his presentation in this movie, and achieved awards from Los Angeles Film Critics Association and Montreal World Film Festival.

Mark Ruffalo also did other noteworthy roles in such movies XX/XY (2002), Isabel Coixet's My Life Without Me along with Sarah Polley (2003), Jane Campion's In the Cut along with Meg Ryan (2003), Michel Gondry's Eternal Sunshine of the Spotless Mind (2004), and We Don't Live Here Anymore (2004). It is based upon the 2 short stories written by Andre Dubus. Ruffalo emerged opposite Tom Cruise as a slaughter police officer in Michael Mann's applauded crime-thriller Collateral (2004).

In recent times, Mark Ruffalo has emerged as a dreamy lead in “chick flicks” for instance View From the Top (2002), 13 Going on 30 (2004), Just Like Heaven (2005) and Rumor Has It (2005). And in the year of 2006, Mark Ruffalo starred in Clifford Odette’s Awake and Sing! in the Belasco Theater in New York, for which Mark Ruffalo was selected for Tony Award for Best Featured Actor in a Play. And in March, 2007, Mark Ruffalo emerged in Zodiac as SFPD slaughter inspector Dave Toschi, who ran for inquiry and arrest the Zodiac killer.

Mark Ruffalo Private Life

In the year of 2002, Mark Ruffalo was detected with acoustic neuroma. It is a disease like a brain tumor. Mark Ruffalo had surgery and after some time tumor was initiated to be benevolent. Mark Ruffalo completely recovered from paralysis and got his good health with an energetic life and also film career.

Mark Ruffalo wedded with a French-American actress Sunrise Cagney in June 2000. They have 3 kids: Keen, Bella and Odette.

Mark Ruffalo Political Views

On 4th October, 2006, Mark Ruffalo emerged on daily basis news program Democracy Now! to converse against the combat on Iraq, the Military Commissions Act, torment and Bush government in general. Mark Ruffalo declared his speaking commitment at The World Can't Wait disapproval in New York City on 5th October, 2006.

In October 2007, Mark Ruffalo criticized 9/11 Commission Report as "entirely illegal" and called for re-opening the exploration. Mark Ruffalo stated: "I saw the way they all came down and I am baffled. My first reaction is that buildings don't fall down like that." Ruffalo criticized 9/11 truth movement, stating "There's so much information that's been put out there by truth for 9/11 and it's ... so much of it has been kind of stretched that a lot of people are grabbing a hold of the more kind of sensational parts of what doesn't jibe with the story to discredit the movement."

Filmography of Mark Ruffalo
  • Zodiac (2006)
  • Just Like Heaven (2005)
  • Rumor Has It (2005)
  • All the King's Men (2006)
  • Collateral (2004)
  • Eternal Sunshine of the Spotless Mind (2004)
  • 13 Going on 30 (2004)
  • View from the Top (2003)
  • In the Cut (2003)
  • My Life Without Me (2003)
  • XX/XY (2002)
  • Wind talkers (2002)
  • The Last Castle (2001)
  • You Can Count on Me (2000)
  • Committed (2000)
  • Ride with the Devil (1999)
  • Safe Men (1998)
  • 54 (1998)
  • The Dentist (1996)
  • Apartment 12 (2006)


BIRTHDAYS: Jena Malone (Birthday 21st November), Famous American Actress, Biography of Jena Malone on Career, Personal Life, Awards & Achievements

Full Name: Jena Malone
Sex: Female
Jena Malone Birth date: 21st November, 1984
Jena Malone Birthplace: Sparks, Nevada, USA
Jena Malone Grew Up In: Lake Tahoe, Nevada, USA (until age 10)
Jena Malone Residence: Los Angeles, California, USA
Jena Malone Nationality: American
Jena Malone Height: 5' 6" (1.68 m)
Jena Malone Hair Color: Brown
Jena Malone Education: After a number of years of home schooling, Jena Malone briefly joined the Professional Children's School in New York, but did not last long.
Jena Malone Occupation: singer and Actress
Jena Malone Years active: 1996 — present
Jena Malone Musical Instruments: Guitar and accordion
Jena Malone Label: Social Registry
Jena Malone Mother: Deborah a.k.a. Debbie (born in 1962)

Jena Malone an American actress was born on 21st November, 1984 in Sparks, Nevada. Jena Malone is an artiste. Jena Malone has emerged in movies including Bastard Out of Carolina (1996), Step mom (1998), Donnie Darko (2001), Saved! (2004), and Into the Wild (2007).

Biography of Jena Malone

Jena Malone Early life

Jena Malone lived in twenty-seven diverse locations at the age of 9, including Lake Tahoe, California. Jena Malone was under the shelter of Jena Malone mother Deborah and her girlfriend, whom Jena Malone calls “God mom”. Jena Malone showed her curiosity in acting and her mother was occupied in the community theater. Briefly, Jena Malone shifted to Las Vegas and hated it. Jena Malone convinced her mother to go to Los Angeles.

Jena Malone’s Background

Interests: Jena Malone has curiosity in Renaissance and math. Jena also likes the music of the whole great composers. Jena Malone is home schooled. Jena Malone considers that it has supported her to surpass in every subjects. Jena Malone has also interest in computer and kick box. Jena Malone passes her spare time on the Internet.

Goal: Jena Malone main ambition is to become a director. And Jena Malone considers that as director, you can include a modest of yourself into each part whatever you like.

Family - Jena Malone has a babe sister who was born in 1997.

Jena Malone Career Graph

Jena Malone came in proficient acting with 1996 movie Bastard Out of Carolina. Jena Malone was selected for Independent Spirit Award for the Best Debut Performance and Screen Actors Guild Award for dazzling Performance in TV Film or Miniseries for this job. In 1997, Jena Malone was selected for Golden Globe, and Best actress in the Mini-series or television film, for her character in Hope. And after some years of home schooling, Jena briefly attended Professional Children's School in New York but not a long time. In January 2000, Jena Malone won the legal emancipation by her mother, to block maternal intrusion with her occupation and earnings; Jena Malone has stated that her mom “mishandled” some of her earning.

Her co-produced 2002 film American Girl, a play in which Jena Malone acted. Jena Malone was as a result of feature in the movie Vinyl but Jena Malone had to remove because of filming clashes. Jena Malone was replaced through Michelle Trachtenberg. Jena Malone had her proficient stage debut in Broadway making of Tony Award winning drama Doubt.

In the year of 2007, it was declared that Jena Malone was discharging Jena Malone first single on the Social Registry, New York City tentative music label. Several tracks were placed to her My Space page and the opening single, a 7" vinyl record attributing two tracks, is planned for discharge in 2007. And Pitchfork Media has depicted her melody as "pretty out-there-- bedroom electronics, spaced-out keyboards, and Malone's spare vocals.”

Jena Malone emerged in horrible movie The Ruins, which was unconfined on 4th April, 2008 and also co-starred with Jonathan Tucker, Laura Ramsey, and Shawn Ashmore.

Jena Malone is playing Maura O'Halloran in forthcoming film.

Currently Jena Malone is studying photography and living in Lake Tahoe.

Filmography of Jena Malone
YearTitleRoleNotes
1996Bastard Out of CarolinaRuth Anne 'Bone' Boatwright 
Hidden in AmericaWilla(TV-Movie)
1997ContactYoung Ellie 
Ellen FosterEllen Foster(TV-Movie)
HopeLilly Kate Burns(TV-Movie, Golden Globe Nomination)
1998Step momAnna Harrison 
1999For Love of the GameHeather Aubrey 
The Book of StarsMary McGuire 
2000

CheatersJolie Fitch(TV Movie)

2001The Ballad of Lucy WhippleCalifornia Morning 'Lucy' Whipple(TV-Movie)

Donnie DarkoGretchen Ross 

Life as a HouseAlyssa Beck 

2002The Dangerous Lives of Altar BoysMargie Flynn 

Hitler: The Rise of EvilGeli Raubal 

The BadgeAshley Hardwick 

American GirlRena Grubb(also co-producer)

2003

The United States of LelandBecky Pollard 

Cold MountainFerry Girl 

2004CornEmily Rasmussen(also Associate Producer)

Saved!Mary 

Howl's Moving CastleLettie(voice)

2005The Ballad of Jack and RoseRed Berry 

Pride and PrejudiceLydia Bennet 

2006LyingGrace 
ContainerThe Woman/Speaker (voice) 
2007Four Last SongsFrankie 

The Go-GetterJoely 

Into the WildCarine McCandless 

2008The RuinsAmy 

2009The MessengerKellypost-production



Awards - Jena Malone
YearAwardCategoryResultRole
1996Cable ACE AwardBest Actress in a Movie or MiniseriesNominatedRuth Anne 'Bone' Boatwright
in Bastard Out of Carolina
IndependentSpirit AwardBest Debut PerformanceNominated
SatelliteAwardsBest Performance by an Actress in a Mini-Series orMotion Picture Made For TelevisionNominated
Screen ActorsGuild AwardsOutstanding Performance by a Female Actor in a TV Movieor MiniseriesNominated
Young ArtistAwardBest Performance in a TV Movie/Mini-Series - YoungActressWon
Youngster AwardBest Performance by a Young Actress in a Made For TVMovieNominated
1998Saturn AwardBest Performance by a Younger Actor/ActressWonYoung Ellie in Contact
Golden GlobeAwardBest Performance by an Actress in a Mini-Series orMotion Picture Made for TVNominatedLilly Kate Burns in Hope
Youngster AwardBest Performance by a Young Actress in aMiniseries/Made-for-TV MovieNominated
Young ArtistAwardBest Performance in a TV Movie/Pilot/Mini-Series -Leading Young ActressWonEllen Foster in Ellen Foster
1999BlockbusterEntertainment AwardFavorite Supporting Actress - DramaNominatedAnna Harrison in Step mom
Young ArtistAwardBest Performance in a Feature Film - Leading YoungActressWon
Youngster AwardBest Performance by a Young Actress in a Drama FilmWon
2000BlockbusterEntertainment AwardFavorite Supporting Actress - Drama/RomanceNominatedHeather Aubrey in For Love of the Game
Young ArtistAwardBest Performance in a Feature Film - Supporting YoungActressNominated
Youngster AwardBest Young Actress/Performance in a Motion PictureDramaNominated
2001DVD ExclusiveAwardsBest Supporting ActressWonMary McGuire in The Book of Stars
2004Sonoma Valley Film FestivalImagery HonorsWon-- --
2005SatelliteAwardsBest Actress in a Motion Picture, Comedy or MusicalNominatedMary in Saved!
2008Screen ActorsGuild AwardsOutstanding Performance by a Cast in a Motion PictureNominatedCarine McCandless in Into the Wild
shared with rest of cast


Jena Malone News

The Howie Mandel Show - Jena Malone will be guest on The Howie Mandel Show on Tuesday, 19th January.


BIRTHDAYS: Josh Turner (Birthday 20th November), Famous American Singer, Biography of Josh Turner on Career, Personal Life, Awards & Achievements

Joshua Otis "Josh" Turner an American country music singer-songwriter was born on 20th November, 1977 in Hannah, S.C. Josh Turner signed to the MCA Nashville Records in the year of 2003; Josh Turner made his first appearance on American country music charts with Top 20 single “Long Black Train", a song which achieved critical commendation for its neotraditionalist country styling. And his unveiling album, named Long Black Train, was unconfined in the year of 2004. Josh Turner has been qualified platinum.

In the year of 2005, Josh Turner charted his initial two Number One singles on Billboard country charts: "Would You Go With Me", and "Your Man", equally from his Your Man album, which has been qualified 2* Multi Platinum in US. And the album produced #16-peaking “Me and God”, duo with bluegrass performer Ralph Stanley.

Josh Turner 3rd studio album, named Everything Is Fine, was unconfined in October 2007. It formed the #2 hit "Firecracker" and the #15 "Another Try", a duo with Trisha Year wood.

Biography of Josh Turner

Josh Turner grew up in church. Josh sang the bass and also baritone parts in several choirs. And after high school, Josh shifted to Nashville to follow an occupation in the music and registered in Belmont University. And after passing college, his hatchling career increased on 21st December, 2001. Through Josh Turner debut on Grand Ole Opry, when Josh Turner debuted the song Josh Turner composed titled "Long Black Train." Josh Turner achieved a status acclaim in the mid of the song, and then sang again for encore.

After one month, Josh Turner signed to MCA Nashville. Josh unconfined his debut album, Long Black Train in 2003, and gratitude to hit title trail, it was expert in platinum through the end of 2004.

And in the year of 2006, Josh Turner unconfined his sophomore album, Your Man. The title trail arrived at the No.1 on Billboard's country airplay chart, while did its record, "Would You Go With Me." And this album was specialized in double platinum.

Josh Turner declares that Josh Turner "learned how to whistle really well during that year.” Josh Turner was observed through Vanderbilt tone clinic who suggested him to permit it cure on his own. Though Josh Turner rested his tone back at residence. Josh Turner studied about classical verbal techniques that how ensure of his tone and evade developing additional problems.

After some time, Josh Turner shifted to Nashville to follow a career in the music and joined Belmont University. And at Belmont, Josh Turner went by a classical training verbal program.

2001-2004: Long Black Train

On 21st December, 2001, Josh Turner debuted on Grand Ole Opry with the song Josh Turner e had composed himself, "Long Black Train."

And in the year of 2003, Josh Turner released his debut album. Josh Turner titled Long Black Train. Before its release, Josh Turner had released 7” vinyl singles of “Long Black Train” and "She'll Go on You". Both singles attributed Long Black Train album "Backwoods Boy" as a B-side. Whereas neither "She'll Go on You" nor "Backwoods Boy" were successful while "Long Black Train" passed about forty weeks on Billboard country charts, arriving at a peak of #13 and achieving gold certification. And the 3rd single, "What It Ain't", was less flourishing, reaching #31.

2005-2006: Your Man

In the year of 2006, Josh Turner released his IInd album, “Your Man”. And the album’s foremost single and title track, "Your Man", was also co-written through Jace Everett and unconfined in late 2005. And "Your Man" reached the charts gradually, ultimately reaching #1 in 2006. And Your Man was qualified Gold through the RIAA 4 weeks after its discharge, and afterward went Platinum after six months.

"Would You Go with Me" was second single on the loose from Your Man. and Like the album's title track, "Would You Go with Me" arrived at the apex of the country singles charts, clutching that point for two weeks; it climbed #48 on Billboard Hot 100. Josh Turner also presented it on CMA Awards in November 2006.

In the month of December of 2006, 49th Annual Grammy Award recommendation were declared. Josh Turner achieved nods for the Best Male Country Vocal Performance and for the Best Country Album. Josh Turner performed at Ryman Auditorium where live album was traced, singing a song called, "Church in the Holler." Josh Turner album Josh Turner: Live At The Ryman was verified in April. It is available solely throughout Cracker Barrel restaurants.

2007-2008: Everything Is Fine

Josh Turner’s 3rd studio album for the MCA Nashville, named Everything Is Fine, was unconfined on 30th October, 2007. Its first single, named “Firecracker (song)|Firecracker” has become his 3rd Top Ten hit on the state music charts, peaking at #2. And the IInd single from the Everything Is Fine, a duo with the Trisha Year wood titled "Another Try", was unconfined in late January 2008, peaking at #15. And the title trail has been unconfined as the 3rd single.

Grand Ole Opry Induction

On 29th September, 2007, whereas giving a reward to Roy Clark on the 20th anniversary of Clark on Grand Ole Opry, Josh Turner was called to become an associate of Grand Ole Opry. Josh Turner was introduced through Vince Gill on 27th October, 2007.

Billy Graham Biopic

Josh Turner has filmed a slight role in forthcoming biopic of Billy Graham. Josh Turner will be playing George Beverly Shea. And George Beverly Shea led the music on lots of Graham's campaigns.

Josh Turner Private Life

Josh Turner met Jennifer. In 2003 Josh Turner wedded with her, previous to the discharge of the album. She sings background songs and plays piano in Josh’s road band.

They had a child, Hampton Otis Turner, on 6th October, 2006.

Musical Influences:

"I think the very first [country music] I ever heard was at grandma's house. She loved music - the Stanley Brothers, the Osborne Brothers, a lot of gospel quartets and old Opry stars, Waylon and Johnny Cash."

Tuesday, November 18, 2008

BIRTHDAYS: Jodie Foster (Birthday 19th November), Famous American Actress, Biography of Jodie Foster on Career, Personal Life, Awards & Achievements

Name: Jodie Foster
Jodie Foster Birth Name: Alicia Christian F.
Jodie Foster Born: 19th November, 1962
Jodie Foster Birth Place: Los Angeles, USA
Jodie Foster Nationality: American
Occupation: Actress / Director
Education: Yale University
Jodie Foster Father: Lucius Foster III
Jodie Foster Mother: Evelyn Foster
Jodie Foster Sisters: Constance Foster (-55) Lucinda Foster (-52)
Jodie Foster Brother: Lucius Foster IV
Jodie Foster Children: Kit (09.29.01)
Charles (07.20.98)

Alicia Christian "Jodie" Foster an American director, actress and producer was born on 19th November, 1962 in Los Angeles, California. Jodie Foster has won Golden Globe, BAFTA and two times Academy Award.

Jodie Foster’s earliest noteworthy role came in the year of 1976 as an underage prostitute in Taxi Driver, and for this movie Jodie Foster achieved an Oscar recommendation for the Best Supporting Actress. Jodie Foster won the Oscar award for the Best Actress in 1988 for performing a rape survivor in The Accused. And in the year of 1991, Jodie Foster starred in The Silence of the Lambs as the Clarice Starling, an exceptional FBI apprentice, supporting in a track for a serial killer. And for this performance, Jodie Foster obtained international acclaim and also Oscar Award for the Best Actress. Her roles and films have crossed a broad variety of genres, comprised comedy, romance, crime, thrillers, science fiction and children’s movies. Later popular films contain the box office successes
  • Contact (1997),
  • Panic Room (2002),
  • Flight plan (2005),
  • Inside Man (2006),
  • The Brave One (2007).

Biography of Jodie Foster

Jodie Foster Early Days

Jodie Foster was the daughter of Lucius Fisher Foster III and Evelyn ‘Brandy’ Ella. Jodie Foster father was an Air Force Lieutenant-Colonel. Jodie Foster mother helped her through working as a movie producer. After emerging as a kid a numerous commercials, Jodie Foster formed her initial credited TV appearance on The Doris Day Show. And Jodie Foster first movie role was in 1970 TV movie Menace on the Mountain, which was pursued through several Disney making.

Jodie Foster joined French-speaking prep school, the Lycée Français de Los Angeles, and got the degree of graduation in 1980 as valedictorian. Then Jodie Foster attended the Yale University. Jodie Foster completed B.A. in literature and got the degree of graduation in magna cum laude in 1985.

Jodie Foster Career Graph

Jodie Foster completed about 50 movies and TV appearances in her career. At the age of 3 Jodie Foster started her career as a Coppertone Girl in a television commercial.

When Jodie Foster was 14 years old, Jodie Foster hosted the Saturday Night Live. Jodie Foster thought that Jodie Foster was the youngest girl to host but Drew Barrymore has hosted at age seven. Then Jodie Foster said, “I think all of us when we look back on our childhood, we always think of it as somebody else. It's just a completely different place. But I was lucky to be around in the '70s and to really be making movies in the '70s with some great filmmakers — the most exciting time, for me, in American Cinema. I learned a lot from some very interesting artists -- and I learned a lot about the business at a young age, because, for whatever reason, I was paying attention; so it was kind of invaluable in my career."

In 1980, Jodie Foster took the character of teen fugitive who enrolls with a pair of celebration hustlers in “Carney”. And in the year of 1981, Jodie Foster survived an epidemic of unwanted advertising surrounding John Hinckley Jr.’s murder attempt on the President Reagan, in which he alleged that he was done to amaze Foster.

In the year of 1984, while studying at Yale, Jodie Foster clutched in TV and movies, most particularly as an opponent of an alternative family in the movie "The Hotel New Hampshire."

And in 1987, Jodie Foster occupied in "Five Corners." And in 1988 to 1991, Jodie Foster merged her status with the Oscar-winning depictions of rape causality in “The Accused," and also a recruit FBI representative in Jonathan Dame’s psychological thriller, "The Silence of the Lambs" individually.

In 1991, Jodie Foster had her organizational debut with "Little Man Tate." Jodie Foster chose a topic close to abode, a child sensation that is seized in tug-of-war involving with his teacher (Dianne Wiest) and working-class mother (played by Foster).

In 1992, Jodie Foster worked as a prostitute in Woody Allen’s "Shadows and Fog," and also performed contrary with Richard Gere in attire drama, “Somersby”.

And in 1995, Jodie Foster formed her second managerial attempt in ensemble wit "Home for the Holidays," about a newly fired woman who revisits to her babyhood home to commemorate Thanksgiving with her unconventional family. The movie achieved mixed significant reviews, but her sure treatment of the artists (comprised Robert Downey Jr., Anne Bancroft and Holly Hunter) was cited.

In 1999, Jodie Foster starred in leading role in "Anna and the King" for 20th Century Fox, with executive Andy Tenant. And in 2002, Jodie Foster co-starred and produced as one-legged priest in "The Dangerous Lives of Altar Boys" which premiered at 2002 Sundance Film Festival. Jodie Foster starred in David Fincher's box-office hit, "Panic Room."

Jodie Foster Private Life

Jodie Foster has 2 sons:
  • Charles Foster (20th July, 1998)
  • Christopher “Kit” Foster (29th September, 2001).
Jodie Foster has not exposed the uniqueness of her husband or specifies of their commencement.

Jodie Foster is an atheist. Jodie Foster does not pursue any "traditional religion." Jodie Foster has discussed god of the gaps. Jodie Foster has "great respect for all religions". Jodie Foster passes "a lot of time studying divine texts, whether it's Eastern religion or Western religion.”

Awards for Jodie Foster

2002 - Hollywood Discovery Award for Outstanding Achievement in Acting at the Hollywood Film Festival
1998 - Saturn Award for Contact at the Academy of Science Fiction
1998 - Audience Award for Contact at the Rembrandt Awards
1997 - Douglas Sirk Award for - at the FilmFest Hamburg
1997 - Doctor of Fine Arts for - at the Yale
1997 - Audience Award for - at the European Film Awards
1996 - Actor of the Decade Award for - at the Chicago Film Festival
1996 - Golden Camera for - at the -
1996 - Crystal Award for - at the Women in Film CA
1996 - Vision Award for - at the -
1996 - Board Governors Award for - at the Am. Society of Cinematographers
1996 - Berlinale Camera for - at the Berlin Film Festival
1995 - Actor for Nell at the Screen Actors Guild Awards
1995 - David Award for Nell at the David di Donatello Awards
1995 - for - Nell at the Munich Film Festival
1995 - People's Choice Award for - at the PCA
1995 - SEFCA Award for Nell at the Southeastern Film Critics Association Awards
1995 - Golden Camera for - at the Golden Camera
1995 - SAG Award for Nell at the Screen Actors Guild Awards
1992 - ShoWest Award for - at the ShoWest Convention
1992 - Chainsaw Award for Silence of the Lambs at the Fangoria Awards
1992 - Golden Globes for Silence of the Lambs at the Golden Globes
1992 - Oscar for Silence of the Lambs at the Academy Awards
1992 - Women of the Year- at the Hasty Pudding Theatricals
1992 - BAFTA Film Award for Silence of the Lambs at the British Academy Awards
1991 - - forSilence of the Lambs at the Chicago Film Critics
1991 - Film Excellence Award for - at the -
1991 - Piper Heidsieck Award for Little Man Tate at the Boston Film Festival
1991 - NYFCC for Silence of the Lambs at the New York Film Critics Awards
1989 - Independent Spirit Award for Five Corners at the Independent Spirit Awards
1989 - Oscar for The Accused at the Academy Awards
1989 - KCFCC Award for The Accused at the Kansas City Film Critics Circle Awards
1989 - Golden Globe for The Accused at the Golden Globes
1988 - NBR Award for The Accused at the National Board of Review, USA
1988 - David Award for The Accused at the David di Donatello Awards
1977 - KCFCC Award for Taxi Driver at the Kansas City Film Critics Circle Awards
1978 - Saturn Award for The Little Girl Who Lives Down the Lane at the Saturn Awards
1977 - Special David Award for Taxi Driver at the David di Donatello Awards
1977 - Emmy Award for Rookie of the Year at the Emmy Awards
1977 - NSFC Award for Taxi Driver at the National Society of Film Critics Awards, USA
1977 - BAFTA Film Award for Bugsy Malone at the British Academy Awards
1976 - NSFC Award for Taxi Driver at the National Society of Film Critics
1976 - Italian Comedy Award for Bugsy Malone at the -
1976 - New Generation Award for- at the Los Angeles Film Critics

Nominations for Jodie Foster

2006 - Saturn Award for Flightplan at the Academy of Science Fiction, Fantasy & Horror Films
2003 - Saturn Award for Panic Room at the Academy of Science Fiction, Fantasy & Horror Films
2001 - Daytime Emmy for Outstanding Special Class Special at the Daytime Emmy Awards
1999 - Emmy for The Baby Dance at the Emmy Awards
1998 - Blockbuster Entertainment Award for- Contact at the BEA
1998 - Golden Globe for Contact at the Golden Globes
1995 - Golden Globe for Nell at the Goden Globes
1995 - MTV Movie Award for Nell at the MTV Movie Awards
1995 - Oscar for Nell at the Academy Awards
1992 - Saturn Award for Silence of the Lambs at the Academy of Science Fiction, Fantasy & Horror Films
1992 - ALFS Award for Silence of the Lambs at the London Critics Circle Awards
1990 - BAFTA Film Award for The Accused at the British Academy Awards
1981 - Young Artists Award for Foxes at the Young Artists Awards
1977 - Oscar for Taxi Driver at the Academy Awards
1977 - Golden Globe for Freaky Friday at the Golden Globes
1976 - NYFCC Award for Taxi Driver at the New York Film Critics

BIRTHDAYS: Fabolous (Birthday 18th November), Famous American Rapper, Biography of Fabolous on Career, Personal Life, Awards & Achievements

Fabolous birth name John Jackson. Fabolous an American rapper was born on 18th November, 1977 in Brooklyn district of New York City. Fabolous is famous for his stage name Fabolous. Fabolous was considered amongst the primary east coast rappers affected through Southern hip hop sounds. In 2001, during, Fabolous became famous throughout his hit single “Can’t Deny It”. And Fabolous smack style has also been compared with those rappers Mase and Loon.

Biography of Fabolous

Fabolous Early Life

Fabolous was born of blended Dominican and African American descent to parents Deborah and Luke Jackson. Fabolous developed in Bedford-Stuyvesant area of Brooklyn, New York. And when Memphis Bleak legitimately noticed to the Roc-A-Fella Records, Fabolous seriously determined that it was a great time for him to begin rapping. Fabolous would identify into the DJ Clue’s radio show in late 1998; and Fabolous finished up the free styling for DJ Clue. Fabolous would instantly direct him to his recently-shaped Desert Storm Records.

Fabolous Career Graph

Fabolous Music Career

Fabolous released the single in 1998 named "If They Want It" under his autograph,"Fabolous Sport". And it was unconfined through Def Jam Recordings on an album DJ Clue? The Professional and also as the bonus track on his unveiling album Ghetto Fabolous. And it is available on DJ Kool Kid mix tape, Pound For Pound featuring Fabolous and Jadakiss. And in 2000, Fabolous released the second single by Elektra Records labeled "Gotta Be Thug", which was assumed DJ Clue Presents Backstage Mix tape (soundtrack).

Ghetto Fabolous (2001)

Fabolous was attached with Nate Dogg to create his foremost single "Can't Deny It". And the song selected in Billboard Hot 100, and following album, Ghetto Fabolous, got platinum official recognition. It accomplished number 4 on the Billboard 200. It had 3 singles which graphed on the Rhythmic Top 40 and the Billboard Hot 100 charts. And the primary of those singles is "Can't Deny It" formed by Rick Rock and attributing a chorus through Nate Dogg interpolating Tupac Shakur's song "Ambitionz Az a Ridah". And the additional charting singles were "Young'n (Holla Back)", which is formed by The Neptune and "Trade It All", which attributes singing from Jagged Edge and is also formed through DJ Clue and DURO.

Street Dreams (2003)

Fabolous released his second one album Street Dreams on 4th March, 2003. and powered through the Just Blaze beat and guest lyrics from the Lil' Mo and Mike Shorey, "Can't Let You Go" arrived at number one on Rhythmic Top 40 chart and number 4 on Billboard Hot 100 chart. And "Into You" with Tamia arrived at number 4 on Billboard Hot 100. It released on the Street Dreams was the main single club banger "Trade It All Pt. 2" and “This Is My Party”.

Real Talk (2004)

Fabolous 3rd album Real Talk was unconfined on 5th November, 2004. And the 2 charting singles are his street anthem "Baby," and "Breathe", which attributes Mike Shorey. Fabolous 3d single was “Tit 4 Tat”. Fabolous realizes that owing to poor advertising, this single will not smack it. Fabolous formed the music video for the 4th single, "Do the Damn Thing" price Jackson $30,000. And this song featured Young Jeezy. It became popular to the community throughout the video. At the same year, Fabolous was chosen for the Grammy Award for his alliance on "Dip It Low" remix by Christina Milian. And in early 2006, Fabolous turned to Def Jam and disappeared Atlantic Records who achieved Music in arrival.

From Nothin' to Somethin' (2007)

Fabolous 4th studio album, From Nothin' to Somethin, was on the loose in June 2007. Fabolous achieved the number 1 spot on the Billboard's Top R&B/Hip-Hop Albums and Top Rap Albums charts for initial time in his career graph. It debuted at the number 2 on Billboard 200, selling 159,000 copies in its opening week. And the album was licensed Gold in July 2007. And it is considered his primary album on the Def Jam Recordings.

Further the initial single and video, “Diamonds”, attributes Young Jeezy who emerged on Real Talk track "Do the Damn Thing". And Lil Wayne is attributed on remix. And his second one single was "Return of the Hustle" which attributed Swizz Beats, came out previous to the album discharge, to some applause, but modest airplay. Fabolous 3rd single, "Make Me Better," attributes fellow Def Jam performer Ne-Yo. It is formed by Timberland. And it became major hit to date, standing fourteen weeks at the number one on Hot Rap Track Billboard Chart. And the 4th single was "Baby Don't Go."

Fabolous Private Life

In 2003, Fabolous was seized for having unlicensed revolver in his vehicle. Later his bodyguard showed corroboration of possession for the revolver. Fabolous put his profession on interruption for two years.

Fabolous was wounded on the dawn of 17th October, 2006 in Manhattan. And the Police noticed the rapper and three men escorting him hastening through the red beam and found unlicensed, burdened revolvers in their vehicle leading to their seize. Following they found the weapons, Fabolous was treated at the local hospital.

Awards and Nominations for Fabolous

2008 – Won, ASCAP Rhythm & Soul Music Awards for Top Rap Song for "Make Me Better" (shared with Ne-Yo)

2007 – Nominated, BET Awards for Best Hip-Hop Collabo for "Make Me Better" (shared with Ne-Yo)
2007 – Nominated, Teen Choice Awards for Choice Music: Rap Artist
2007 – Nominated, American Music Award for Favorite Rap/Hip-Hop Male Artist
2007 – Nominated, Grammy Award for Best Rap/Sung Collaboration for "Dip It Low (Remix)" (shared with Christina Milian)

Discography of Fabolous
  • Ghetto Fabolous (2001)
  • Street Dreams (2003)
  • Real Talk (2004)
  • From Nothin' to Somethin' (2007)
  • Loso's Way (2009)

Friday, November 14, 2008

BIRTHDAYS: Miley Cyrus (Birthday 23rd November), Famous American Actress & Singer, Biography of Miley Cyrus on Career, Personal Life, Achievements

Miley Cyrus Birth Details

Miley Ray Cyrus was born in Nashville, Tennessee on November 23, 1992.

Importance

• Miley Cyrus is an American artist and singer.
• Miley Cyrus is a songwriter as well.
• Miley Cyrus is popularly known for performing as Miley Stewart in the television program Hannah Montana on the Disney Channel.

Miley Cyrus Childhood Details

• Miley Cyrus mother is Leticia and father is a singer, Billy Ray Cyrus. Miley Cyrus has two elder brothers Trace and Christopher Cody.
• Trace is a vocalist and guitarist of a rock band named Metro Station in California.
• Miley Cyrus also has a sister named Brandi. Miley Cyrus has a younger brother, Braison, as well as a younger sister, Noah. Noah is an actress.
• Miley Cyrus was named Destiny Hope when she was born, as her parents believed that Miley Cyrus would achieve great things in her life.
• Miley Cyrus was given nickname "Miley" because she kept smiling a lot as a youngster.
• Miley Cyrus attended Heritage Middle School. Miley Cyrus was a cheerleader there. Presently Miley Cyrus goes to school at a place known as Options for Youth. Miley Cyrus is guided by a private tutor on the sets of her T.V. show. Miley Cyrus was raised on her parents' farm outside of Nashville, Tennessee where she used to attend The People's Church in Nashville, Tennessee.

Miley Cyrus Acting Career

• Miley got inclined towards acting at the age of nine only. At that time Miley Cyrus family lived in Toronto, Ontario, Canada for a short duration.
• Miley Cyrus starred first as a guest star on her father's television series. Miley Cyrus acted as a girl named Kylie.
• In 2003, Miley Cyrus also portrayed as “Young Ruthie" in Tim Burton's Big Fish. Later in the year, Miley Cyrus appeared in a music video, "If Heartaches Have Wings". Miley Cyrus also appeared on Colgate Country Showdown hosted by her father.
• Miley Cyrus became a celebrity after Hannah Montana first appearance in March 2006.
• In October 2006, owing to the success of the series, a soundtrack CD was recorded and released. Around eight songs were sung by her, in the CD.
• In the year 2007, Miley Cyrus grabbed the 17th rank in the list of "Forbes Top Twenty Superstar Earners under the age of 25".
• Moreover, Miley Cyrus had an annual earning, estimated around US$3.5 million. Presently Miley Cyrus is working on a movie sequel of Hannah Montana.
• It is titled “Hannah Montana” and proposed to release in April, 2009.
• Miley Cyrus started her solo music career with the release of the first album, “Meet Miley Cyrus”. It was released on June 23, 2007.
• Miley Cyrus next album, “Breakout” was out on July 22, 2008. Breakout album did not involve the Hannah Montana franchise. Both albums were charted #1 on the Billboard 2008.
• In the year 2008, Miley Cyrus was enrolled as one of Time magazine's “100 Most Influential People in The World”, which included artists and entertainers.

Miley Cyrus Personal Life

• Miley Cyrus is very friendly with fellow Hannah Montana co-stars.
• Miley Cyrus enjoys special friendship with Emily Osment and Mitchel Musso.
• Miley Cyrus also trained Emily Osment, to play guitar and Osment trained Miley how to knit.
• Miley Cyrus is also friends with the stars of other successful shows.
• Miley Cyrus friends include Vanessa Hudgens and Zac Efron, Brenda Song, and Ashley Tisdale.
• In the Oprah Winfrey Show, she expressed that Hilary Duff is her idea role model. Miley Cyrus is very fond of pets and has many pets such as horses, dogs, cats, fish, and chickens. Cyrus officially changed her name to "Miley Ray Cyrus." The middle name reflects her father's name.
• In an interview she stated that Miley Cyrus goes to church regularly with her family.
• In February 2008, Miley Cyrus and her friend Mandy Jiroux have started shooting and creating videos on YouTube.
• It is known as The Miley and Mandy Show.
• The show is a "YouTube hit".
• It is known to be filmed for fun by Cyrus and Jiroux.
• It is mostly shot in Miley's bedroom.
• Miley Cyrus has also made contribution to the City of Hope, a cancer research center.
• Miley Cyrus donated $1 for every "Hannah Montana" concert ticket sold.


Tuesday, November 11, 2008

BIRTHDAYS: Sisqo (Birthday 9th November), Famous American Singer, Biography of Sisqo on Career, Personal Life, Awards & Achievements

Mark Althavan Andrews was born on 9th November 1978 in Baltimore. Sisqo is recognized well by his theatre name Sisqo. Sisqo is American R&B actor and singer and is also the Grammy Award nominee. Sisqo is known best for being leader singer of Thong Song and the Dru Hill which is the R&B group. Sisqo first song from the Unleash the Dragon became the worldwide hit.

Biography of Sisqo:

Sisqo met with the Dru Hill and James Woody Green at the time of the middle school. Afterwards they were recruited by the Tamir Nokio Ruffin for creating the Dru Hill which was named after the Druid Hill Park. Almost immediately Larry Jazz Anthony added to line-up.

Releasing the large number of the successful singles and 2 platinum LPs, the Dru was the chief R&B success in 1990’s. The vocal style of the Sisqo was very much common with the K- Ci form the Jodeci. Large number of the people including K-Ci criticized Sisqo for opting the singing style of the K- Ci, where as Sisqo himself goes for the record several times naming the K- Ci as his main influence. In among the albums of the Dru Hill, Sisqo wrote the two striking singles for Label mate Mya. Sisqo also appeared as the

guest Performer in the Its All about Me.

Dru Hill reunion, solo career and acting

In the year 1999 when the Green left the Dru Hill for pursuing the solo career, the decision was taken the remaining three members will also do same. The first solo debut of Sisqo was Unleash the Dragon, which was released in the year 1999 on Def Soul Records. His first debut was sold moderately till February 2000 release of the second debut of Sisqo Thong Song. The conflicts with the group prevented Hill from reuniting them as planned in the year 2000 and Sisqo planned about to record the second solo LP. In this period Sisqo branched in hosting the programs of the dance competitions sisqo’s shakedown on MTV and the movies, taking the supporting roles in the films get over it. Though his other LP, Return of the Dragon released in year 2001 in June eventually with Dance with me and Can I live performed below potentials and by the year 2002, Sisqo was again back with the Dru Hill who released their LP in the year 2002. The visual trademarks of Sisqo are this stage costumes and hair styles.

Awards/nominations of Sisqo:

American Music Awards:
  1. Favourite R&B/ Soul in the year 2001 for the Album: Unleash the Dragon (nominated)
  2. Favourite Male R&B/ Soul Artist (nominated)
Grammy Awards:
  • Best R&B song Thong song in the year 2001 (nominated)
  • Best R&B Male Vocal Performance Thong Song in the year 2001 (nominated)
  • Best R&B album: Unleash the Dragon in the year 2001 (nominated)
  • Best New Artist in the year 2001 (nominated)
MOBO Awards:
  • Best Video Thong Song in the year 2000 (nominated)
  • Best R&B Act in the year 2000 (nominated)
  • Best R&B Act in the year 2001 (nominated)
MTV Video Music Awards:
  • Viewer’s Choice Thong Song in the year 2000 (nominated)
  • Best Hip- Hop Video Thong Song in the year 2000
  • Best Dance Video Thong Song in the year 2000 (nominated)
  • Best Video from a Film Thong Song in the year 2000 (nominated)
  • Best New Artist for Thong Song in the year 2000 (nominated)
Soul Train Music Awards:
  • Favourite Male R&B/ Soul Album for Unleash the Dragon in the year 2001 (nominated)
  • Filmography of Sisqo:

Film Appearances:
  • Pieces of April in the year 2003
  • Surf School in the year 2006
  • Snow Dogs in the year 2002
  • Get over it in the year 2001
Television Appearances:
  • I Love the New Millennium in the year 2008
  • Sabrina, the Teenage Witch in the year 2001
  • Sisqo’s Shakedown in the year 2000
  • Gone Country in the year 2008
Mix tapes:
  • This is in the Heart in the year 2001
  • In da Club in the year 2003
  • One Love in the year 2004
  • Really real in the year 2004
  • So Seductive in the year 2004
  • One Finger in the year 2005
  • Champaigne and Henessy in the year 2008
Sisqo Solo Discography:

Sisqo Albums:
  • Unleash the Dragon in the year 1999
  • Returns of the Dragon in the year 2001
  • Last Dragon in the year 2008


BIRTHDAYS: Parker Posey (Birthday 8th November), Famous American Actress, Biography of Parker Posey on Career, Personal Life, Achievements

Parker Christian Posey was born on 8th November 1968. Parker Posey is an American Hollywood star and became popular in the era of 1990’s after the series of the roles in the numerous of the well- received self- governing films. As the result of it, Parker Posey has been referred as “Queen of Indies”.

Parker Posey Early Life

Parker Posey was born in Maryland in Baltimore, and is the daughter of the Lynda and Chris. Parker Posey has the fraternal twin brother. The first name of the Posey was the tribute which was given to her by her father after the name of the super model of 1950’s Suzy Parker. After Parker Posey birth, the entire family moved to Mississippi in Laurel, where her father opened the dealership which was named as Posey Chevrolet and her mother worked as the chef.

Parker Posey Film Career

Parker Posey attended State University of the New York at the Purchase where Parker Posey shared the room with another Hollywood star Sherry String field. The fellow professionals of the entertainment in the acting company of the SUNY purchase consists of the producer Todd Baker and actors, Reno Wilson and Adam Trese. Parker Posey got first break in the television where Parker Posey won role of the Tess Shelby on daytime serial opera As the World Turns. Parker Posey got the first main role in the year 1993 in movie Dazed and Confused.

In the late 1990’s Parker Posey starred in the plenty of self governing movies and then by Time Magazine Parker Posey was named as the Queen of the Indies that cited the 32 self- governing movies to Parker Posey’s credit, consisting Clock watchers, The House of Yes, Party Girl and Personal Velocity. Parker is the part of acting company which appears in the films of the director Christopher Guest’s, which includes the Best in show in the year 2000, mock documentaries in the year 1996, for you consideration in the year 2006 and a might wind in the year 2003. Parker Posey is also the favourite of the director Hal Hartley.

Although Parker Posey is recognized well for her outstanding work in the self- governing cinema, Parker Posey also has the sustaining roles in number of big budgets films which consists of the Josie and the Pussycats, Blade: Trinity, You have got mail and Laws of Attraction. Parker Posey has also given the very notable performance in Superman Returns. Parker Posey is also working with the John Waters in his forthcoming film Fruitcake with Johnny Knoxville.

Television Works of Parker Posey:
  • Though Parker Posey chiefly works in the films, but Parker Posey has also worked in many of the television projects.
  • Parker Posey worked in adaptations of the television miniseries of Armistead Maupin Tales of the city books, where the name of her character was Connie
  • Parker Posey provided the voice of the Umbriel the mermaid in episode of The Deep south in the year 2000
  • Parker Posey also provided the voice of the Becky in episode of the Simpsons particularly in the year 2000
  • Parker Posey also had very notable role in the television series Will and Grace
  • Parker Posey also appeared on final episode of the project runway in the year 2005.
  • Parker Posey also made the guest appearance in the Boston Legal which was the legal drama in the year 2006
  • In the year 2008 Parker Posey cancelled the Return of Jezebel James which was the fox series.

Previously Parker Posey was considered for roles of Rachel Green in the friends, Kimmy in the movie My Best Friend’s wedding and for the Althea in The people vs. Larry Flynt.

Filmography of Parker Posey:

Parker Posey worked in the plenty of the films and has given notable appearances in the films. Some of the movies of the Parker Posey are:
  • Dazed and Confused in the year 1993
  • Sleep with me in the year 1994
  • Party Girl in the year 1995
  • Frisk in the year 1995
  • Basquiat in the year 1996
  • The House of yes in the year 1996
  • Waiting for Guff man in the year 1997
  • Clock watchers in the year 1997
  • You have got mail in the year 1998
  • Best in Show in the year 1998
  • Scream 3 in the year 2000
  • The Anniversary Party in the year 2001
  • Personal Velocity in the year 2002
  • The Event in the year 2003
  • Frankenstein in the year 2004
  • Adam & eve in the year 2005
  • Superman Returns in the year 2006
  • Broken English in the year 2007
  • Spring breakdown in the year 2008

BIRTHDAYS: Miranda Lambert (Birthday 10th November), Famous American Singer, Biography of Miranda Lambert on Career, Personal Life, Awards

Miranda Lambert was born on 10th November 1983 in Texas and is also the two times Grammy award nominated American singer. Miranda Lambert gained the fames as the finalist of Nashville star in the year 2003. Here Miranda Lambert gained third place and afterwards she signed to the Epic Records. Miranda Lambert made her first debut in the year 2005 with the album Kerosene. Miranda Lambert also produced singles Bring Me Down, New Strings and Kerosene. All the four singles were top 40 hits on the charts of the Billboard Hot Country Songs.

Miranda Lambert was transferred to the Columbia records for Crazy Ex- Girlfriend which was her second album. This album was released in the year 2007. Though the title track of the album was failed to reach up to the top 40 but the next two tracks Gunpowder & Lead and Famous in a Small Town became the highest charting tracks and made her first top 10 hit of the country in the mid of the year 2008.

Biography of Miranda Lambert
Grew in Texas. Miranda Lambert’s father, Richard Lee Rick Lambert is the retired police cop and later on he became the private detective with Beverly June Lambert, Miranda Lambert mother. At the early age Miranda Lambert was taught to shoot and later on she became the keen deer hunter. Miranda Lambert attended the concert of the Garth Brooks at the age of nine years where Miranda Lambert stood at ninth position and this made her interest in the country music. Miranda Lambert father performed and wrote in the country music and she started singing in the talent contest under tutelage.

Discography of Miranda Lambert

Miranda Lambert Albums:
Kerosene in the year 2005
Crazy Ex- Girlfriend in the year 2007

Awards winner/nominations of Miranda Lambert

Country Music Association Award:
  • Nominated for horizon award in the year 2005
  • Nominated for horizon award in the year 2006
  • Nominated for female vocalist of the year 2008
  • Nominated for single of the year in the year 2008 for Gunpowder& Lead

CMT Music Awards:
  • Nominated for female video of the year in the year 2006 for kerosene
  • Nominated for breakthrough video of the year in the year 2006 for Kerosene
  • Nominated for female vocalist of the year 2007

Academy of Country Music Awards:
  • Won the top new female vocalist in the year 2007
  • Nominated for female vocalist of the year in 2007
  • Won for the album of the year 2008 for crazy ex girlfriend

Grammy Awards:
  • Nominated for Best female country vocal performance in the year 2006 for Kerosene
  • Nominated for Best female country vocal performance in the year 2007 for famous in a small town

Band:
  • Keith Zebroski- drums
  • Alex Weeden- lead guitar
  • Scotty Wray- lap steel guitar, ganjo, resonator guitar, rhythm guitar
  • Chris Kline- harmonica, percussion, jaw harp, guitar, keyboard
  • Aden Bubeck- bass guitar

Miranda Lambert Music Career:

In the year 2003, Miranda Lambert auditioned for Nashville Star which was the talent competition and eventually completed with the third place in show. On 15th September 2003, Miranda Lambert made the contact with the Epic Records and made debut single in me and Charlie Talking which was released in the year 2004. Kerosene her first album comprised of the 12 songs out of which 11 songs were written by her. The album got the Platinum certification by RIAA for delivering more than 1 million copies. Her second album was released in the year 2007, crazy ex-girlfriend. Miranda Lambert also wrote 11 tracks for eight albums consisting 4 singles. In the year 2005, Miranda Lambert won the Cover Girl Fresh Face of the country in the 40th annual Academy of the Country music awards. Miranda Lambert also received the nomination for the Grammy award in the year 2006 and 2007. In the year 2007 Miranda Lambert started dating singer Blake Shelton. Miranda Lambert also sang the background vocals for the Shelton’s single “Home” in the year 2008.

Touring personnel:
  • Charlie Sherman- bus driver
  • Riley Moss- backline tech
  • Chad Pavlovich- backline tech
  • Jason Macalick- backup bus driver, front of house engineer
  • Jose Raices- merchandise manager
  • Jordan Powell- tour manager
  • Chris Newsome- production manager, stage manager, monitors engineer
  • David Sherman- bus driver
  • Sean Semler- lighting director


EVENTS: All Souls Day (2nd November), All Souls Day History, Trailer, All Souls Day Mass, All Souls Day Activities, All Souls Day 2009

All Souls Day is on November 2, just subsequent to the All Saint's Day and is an official public holiday of the Catholic Calendar. It is a Roman Catholic day of tribute for friends and loved ones who have gone for their heavenly abode. All Souls Day has its extraction in the early Pagan Festival of the Dead, based on the pagan faith that the souls of the dead would come back for a meal with the family. Candles kept in the window direct the souls back home and a different place was set at the bench. Children came asking for food to be presented emblematically to the dead, but then dispersed them amongst the hungry.

All Souls Day is also recognized as the Feast of All Souls, tribute of all the Faithful Departed

Catholics consider that persons who die are not straight away qualified for the beatific vision that is the authenticity and decency of God and heaven and need to be wash out of their sins. The Catholic Church calls this refinement of the elect "purgatory." The Catholic church uphold that
(a) there will be a distillation of the believers preceding to entering heaven and,
(b) the prayers and masses of the authentic help those in the state of distillation.

In All Souls Day the friends and relatives of the departed souls pray and offer funeral hymn masses. There are three Requiem Masses that are said by the clergy to help the souls from Purgatory to Heaven: one for the chief priest, one in favor of the departed, and one intended for the pope. While the Feast of All Saints is a day to memorize the magnificence of Heaven and those there, the Feast of All Souls reminds us of our responsibility to live lives on the holy path and that there will be distillation of the souls of those fated for Heaven. A candle will be placed for all departed soul, and they are decorated in some manner. Anger is also often used, and memento, photos, and other remembrances of the dead.
It is also habitual of playing Don Juan Tenorio in various locations to see. Paper mache and sugar skulls are trendy, as are cardboard coffins from which a carcass can be made to leap out. Unusual masks are also worn, permitting a person to attain a facial look for which they believe they are lacking to achieve.

Primarily and fore mostly, the Days of the Dead is a time when the families lovingly remember the deceased. But it is also a time noticeable by celebrations, including stunning parades of skeletons and ghosts. In one prominent tradition, revelers lead a mock funeral march with a live person within a sarcophagus.

All Souls Day History

The Feast of All Souls has its commencement to seventh century monks who determined to offer the mass on the day after Pentecost for their dead community members. Nevertheless, the choice of the date (Nov 2) for All Souls Day is credited to St. Odilo, the fifth abbot of Cluny (city of France famous for the Abby), since he wanted to pursue the illustration of Cluny in offering special prayers and singing the Office of the Dead on the day subsequent to the banquet of All Saints.

The current view of death is obtained in part from Pre-Hispanic times. The Aztecs played a very significant role in the expansion of this custom. Through their record, this festival came out as one with a lot of details and with a varied understanding to it. According to the Aztec beliefs, after a person's loss his soul would go by nine stages before they reached Mictlan - the place of the dead. The Aztecs also supposed that a person's fate was established at birth and that the spirit of that human being actually depends upon the kind of death rather than the kind of life they lead. The type of a person's death would also decide what region they would go to. Once they arrived to their exact region, a person's soul would either wait for the alteration or remain, awaiting the next fate.

The Spanish Conquest of 1521 brought about an merger of the Catholic

Labels:

Monday, November 10, 2008

Aston Villa Football Club, English Professional Football Club, Aston Villa Football Club History, Records, Aston Villa Football Club Current Squared

Aston Villa Football Club is English professional football club. Aston Villa Football Club founded in 1874.
Full nameAston Villa Football Club
Nickname(s)The Villa, The Villans, VillaThe Lions
Founded1874
GroundVilla Park
Aston
Birmingham B6 6HE
England
(Capacity: 42,640)
ChairmanRandy Lerner
ManagerMartin O'Neill
LeaguePremier League
2007–08Premier League, 6th


Aston Villa Football Club won:
  • First Division Championship 7 times
  • FA Cup 7 times
  • 1981–82 European Cup
Aston Villa Club Honors

European

European Cup Winners 1: 1982
European Super Cup Winners 1: 1982–83
InterToto Cup Winners 1: 2001

Domestic

League titles
First Division Champions 7: 1893–94, 1895–96, 1896–97, 1898–99, 1899–1900, 1909–10, 1980–81
Second Division Champions 2: 1937–38, 1959–60
Third Division Champions 1: 1971–72

Cups
FA Cup Winners 7: 1887, 1895, 1897, 1905, 1913, 1920, 1957
League Cup Winners 5: 1961, 1975, 1977, 1994, 1996
Charity Shield Winners 1: 1981 (shared)

Aston Villa Football Club Current Squad
No.PositionPlayer
1 GKBrad Friedel
2 DFLuke Young
3 DFWilfred Bouma
4 MFSteve Sidwell
5 DFMartin Laursen (Captain)
6 MFGareth Barry
7 MFAshley Young
8 MFJames Milner
9 FWMarlon Harewood
10 FWJohn Carew
11 FWGabriel Agbonlahor
13 GKStuart Taylor
No.PositionPlayer
14 FWNathan Delfouneso
15 DFCurtis Davies
16 DFZat Knight
17 MFMoustapha Salifou
18 MFWayne Routledge
19 MFStiliyan Petrov
20 MFNigel Reo-Coker (vice-captain)
21 DFNicky Shorey
22 GKBrad Guzan
24 DFCarlos Cuéllar
26 MFCraig Gardner
27 MFIsaiah Osbourne


Aston Villa Football Club Current Management and Coaching Staff
NameNationalityRole
Martin O'NeillNorthern IrelandManager
John RobertsonScotlandAssistant Manager
Steve WalfordEnglandFirst Team Coach
Kevin MacDonaldScotlandReserve Team Coach
Seamus McDonaghEnglandGoalkeeping Coach
Gordon CowansEnglandHead Youth Team Coach
Alan SmithEnglandPhysiotherapist


Aston Villa Football Club Board Officials
NameNationalityRole
Randy LernerUnited StatesChairman
Charles KrulakUnited StatesNon-Executive Director
Bob KainUnited StatesNon-Executive Director
Michael MartinUnited StatesNon-Executive Director




Labels:

NEWS: Bart Cummings (Birthday 14th November), Famous Australian racehorse trainer, Biography of Bart Cummings on Career, Achievements, Melbourne Cup

Bart Cummings
Bart Cummings was born 14th November in 1927 at Adelaide, Bart Cummings had won the melbourne cup at the age of 23 years In 1950 when he won this cup for first time he honoured this cup to his fatherJim Cummings. Bart Cummings was the winner of 11 Melbourne Cupand 5quinellas with that Bart Cummings has earnedthe title of “ Cups King ”.

Bart is leading the current Group 1 trainers list with 249 Group 1 winners.

11 Melbourne Cups

1965, 1966, 1967, 1974, 1975, 1977, 1979, 1990, 1991, 1996, 1999

Rogan Josh - 1999 (with Zazabelle 3rd)

31Derby’s

(10 SAJC, 8 WATC, 5 VRC, 4 AJC,3 QTC, 1 TRC)

1958 - 2007

`Dayana` - winner of four Derby's in 1972

23 Oaks

(8 VRC, 7 AJC, 6 SAJC, 1 QTC, 1 WATC)

1964 - 2001

`Magical Miss` - VRC Oaks winner 2001

6 Caulfield Cups

1966, 1969, 1974, 1977, 1980, 1991

`Ming Dynasty` - dual winner 1977 & 1980

3 Cox Plates

Taj Rossi - 1973

Saintly -1996

Dane Ripper - 1997

4 Golden Slippers

1966, 1973, 1976, 1979

`Tontonan` - 5 times Group 1 winner, including 1973 Golden Slipper

5 Doncaster Handicaps

1974, 1977, 1978, 1986, 1998

`Catalan Opening` - 1998

13 Australian Cups

1968, 1973, 1975, 1976, 1977, 1978, 1980, 1981, 1985, 1992, 1996, 1998, 2008

`Let's Elope` - 1992

10Mackinnon Stakes

1959, 1970, 1974, 1976, 1980, 1981, 1984, 1991, 1999, 2007

`Bounty Hawk` - 1984

8 Newmarket Handicaps

1972, 1973, 1975, 1978, 1979, 1981, 1990, 1991

5 Caulfield Guineas

1966, 1974, 1996, 2005, 2006

5 Thousand Guineas

1963, 1989, 1991, 1996, 2001

16 Sires Produce Stakes

(AJC x 2, QTC x 1, SAJC x 8, VRC x 5)

1966-1993

7 Lightning Stakes

1967, 1974, 1975, 1977, 1978, 1986, 1991

5 Flight Stakes

1974, 1976, 1977, 1994, 1996

4 Champion Stakes

1974, 1981, 1987, 1989

4 Stradbroke Handicaps

1988, 1989, 1993, 1997

16 St Legers

(SAJC x 8, AJC x 1, VRC x 7)

1965-2005

1972/73 - Dayana

(VRC, SAJC, WATC, WATC Australian Derby’s, WATC Perth Cup)

1973/74 - Taj Rossi

(MVRC Cox Plate, VRC Derby, VRC George Adams)

1974/75 - Leilani

(AJC Oaks, VATC Toorak Hcp, Caulfield Cup, CF Orr, VRC Mackinnon, Australian Cup)

1975/76 - Lord Dudley

(VATC Blue Diamond, VRC Sires Produce, Australian Cup, MVRC Manikato
Stakes, William Reid stakes)

1977/78 - Maybe Mahal

(VRC Craven Stakes, George Adams Hcp, Lightening Stakes, Newmarket
Hcp, BTC Doomben 10,000, AJC Doncaster)

1980/81 - Hyperno

(VRC Melbourne Cup, Australian Cup, VATC Caulfield Stakes, STC Rawson Stakes

1987/88 - Beau Zam

(AJC Spring Champion, STC Rawson Stakes-twice, STC Tancred Stakes, AJC Derby)

1991/92 - Let’s Elope

(VATC Caulfield Cup, CF Orr Stakes VRC Mackinnon Stakes, Melbourne Cup,
Australian Cup)

1996/97 - Saintly

(VRC Australian Cup, Melbourne Cup, MVRC Cox Plate, VATC CF Orr Stakes)


Bart Cummings Melbourne Cup runners :

1958

1959

Asian Court

Trellios 5th



1961Sometime 6th

1965LIGHT FINGERS 1stZiema 2ndThe Dip 18th
1966GALILEE 1stLight Fingers 2nd
1967RED HANDED 1stFulmen 9thZiema 12th
1968Lowland 4thArctic Coast 6thSwift General 23rd
1969Swift General 5thGeneral Command 13thThe Sharper 20th
1970Tavel 4thVoleur 6thMoomba Fox 19th
1971Pilgarlic 10thTavel 10th
1973Dayana 12th

1974THINK BIG 1stLeilani 2nd
1975THINK BIG 1stHoliday Waggon 2ndLeica Lover 20th
1976Gold And Black 2nd

1977GOLD& BLACK 1stMing Dynasty 8thVacuum 20th
1978Panamint 10thVive Velours 11thBelmura Lad 13th, Stormy Rex 20th
1979HYPERNO 1stSafe Harbour 21st
1980La Zap 6thHyperno 7thMing Dynasty 17th
1981Hyperno 6thBelmura Lad 7thNo Peer 8th
1982My Sir Avon 4th

1983Mr Jazz 3rdNo Peer 4th
1984Bounty Hawk 15th

1986Empire Rose 5th

1987Rosedale 3rd

1988Round The World 5th

1990KINGSTON RULE 1stLa Tristia 9th
1991LET'S ELOPE 1stShiva's Revenge 2ndWeekend Delight 22nd
1992London Bridge 9th

1993Great Vintage 4thFrontier Boy 5th,Tennesse Jack 6th, Our Tristalight 24th
1994Gossips 14th

1996SAINTLY 1stMy Kiwi Gold 21st
1997Alfa 19thGrandmaster 11th
1998Perpetual Check 9th

1999ROGAN JOSH 1stZazabelle 3rdRebbor 23rd
2002Miss Meliss 10th

2003Frightening 11th

2004Strasbourg 10th

2005Kamsky 16thStrasbourg 18th
2007Sirmione 12th


Summary of Bart Cummings:78 Runners, 12 Winners,9 Placegetters

15% strike rate win

12% strike rate place

27% strike rate win/place

5quinellas

Labels:

Atletico Madrid, Spanish Football Club, Atletico Madrid History, Stadium, Atletico Madrid Trophies Won, Current Squared, Atletico Madrid Presidents

Atletico Madrid is Spanish football club. Atletico Madrid full name is Club Atletico de Madrid. Atletico Madrid was founded April 26, 1903 as as Athletic Club de Madrid and October 4, 1939 as Club Atletico de Madrid. Atletico Madrid home stadium is the Vicente Calderon Stadium. 55 thousands spectators can hold in Vicente Calderon Stadium. Atletico Madrid club in 9 occasions won both La Liga and the Copa del Rey.

Atletico Madrid also won
  • European Cup Winners Cup - 1962
  • European Cup runners-up - 1974
  • Intercontinental Cup winners - 1974.

Atletico Madrid Trophies

La Liga
Winners (9): 1939–40, 1940–1941, 1949–1950, 1950–1951, 1965–1966, 1969–1970, 1972–1973, 1976–1977, 1995–1996
Runners-up (8): 1943-44, 1957-58, 1960-61, 1962-63, 1964-65, 1973-74, 1984-85, 1990-91

Copa del Rey
Winners (9): 1959–1960, 1960–1961, 1964–1965, 1971–1972, 1975–1976, 1984–1985, 1990–1991, 1991–1992, 1995–1996
Runners-up (8): 1920-21, 1925-26, 1955-56, 1963-64, 1974-75, 1986-87, 1998-99, 1999-00

Supercopa de España
Winners (3): 1940, 1951, 1985
Runners-up (4): 1950, 1991, 1992, 1996

European Cup/UEFA Champions League: Runners-up (1): 1973–1974
Intercontinental Cup: Winners (1): 1974

UEFA Cup Winners' Cup
Winners (1): 1961-62
Runners-up (2): 1962-63, 1985-86

UEFA Intertoto Cup
Winners (1): 2007
Runners-up (1): 2004

Segunda Division
Winners (1): 2001-02
Runners-up (3): 1932-33, 1933-34,

Campeonato del Centro: 4 1920-21, 1924-25, 1927-28, 1939-40

Atletico Madrid Current Squard
No.PositionPlayer
1GKGrégory Coupet
2DFGiourkas Seitaridis
3DFAntonio López
4DFMariano Pernía
5DFJohn Heitinga
7FWDiego Forlán
8MFRaúl García
9MFLuis García
10FWSergio Agüero
11MFMaxi Rodríguez (captain)
12MFPaulo Assunção
14FWFlorent Sinama-Pongolle

No.PositionPlayer
16MFÉver Banega (on loan from Valencia)
17DFTomáš Ujfaluši
18MFManiche
19MFMiguel de las Cuevas
20MFSimão
21DFLuis Perea
22DFPablo
24MFIgnacio Camacho
25GKLeo Franco
27GKÁngel Bernabé
28DFÁlvaro Domínguez
33MFSergio Gontán


Out on Loan
No.PositionPlayer
––MFDiego Costa (at Albacete)
––MFJosé Manuel Jurado (at Mallorca)
––MFJosé Antonio Reyes (at Benfica)
––MFCléber Santana (at Mallorca)


Atletico Madrid Presidents
  • Enrique Allende: 1903
  • Eduardo de Acha: 1903-1907
  • Ricardo de Gondra: 1907-1909
  • Ramón de Cárdenas: 1909-1912
  • Julián Ruete: 1912-1919
  • Álvaro de Aguilar: 1919-1920
  • Julián Ruete: 1920-1923
  • Juan de Estefanía: 1923-1926
  • Luciano Urquijo: 1926-1931
  • Rafael González: 1931-1935
  • José L. del Valle: 1935-1936
  • José María Fernández: 1936-1939
  • Francisco Vives: 1939
  • Luis Navarro: 1939-1941
  • Manuel Gallego: 1941–1945
  • Juan Touzón: 1946-1947
  • Cesáreo Galindez: 1947-1952
  • Marqués de la Florida: 1952-1955
  • Juan Suevos: 1955
  • Javier Barroso: 1955-1964
  • Vicente Calderón: 1964-1980
  • Ricardo Irezábal: 1980
  • Alfonso Cabeza: 1980-1982
  • Antonio del Hoyo: 1982
  • Agustín Cotorruelo: 1982
  • Vicente Calderón: 1982-1987
  • Francisco Castedo: 1987
  • Jesús Gil: 1987-2003
  • Enrique Cerezo: 2003-


Atletico Madrid Current Board

Atletico Madrid President: Mr. Enrique Cerezo Torres
Atletico Madrid General Manager / Delegate to the Board: Mr. Miguel Ángel Gil Marín
Atletico Madrid Secretary to the Board: Mr. Pablo Jiménez de Parga Maseda
Atletico Madrid Sports Director: Mr. Jesús García Pitarch
Atletico Madrid PR & Communications Director: Mr. Emilio Gutíerrez
Atletico Madrid Financial Director: Mr. Mario Aragón
Atletico Madrid Marketing & Sales Director: Mr. Guillermo Moraleda
Atletico Madrid Board Members:
  • Mr. Jesús Gil Marín,
  • Mr. Óscar Gil Marín,
  • Ms. Myriam Gil Marín,
  • Mr. Severiano Gil y Gil,
  • Mr. Miguel Pérez Cano,
  • Mr. Lázaro Albarracín Martínez,
  • Mr. Fernando García Abásolo,
  • Mr. Antonio Alonso Sanz,
  • Mr. Manuel Herrero Porta and
  • Mr. Mario Rodríguez Valderas

Atletico Madrid Statistics 2007/08

Top Scorers:
  • Sergio Agüero - 19 goals
  • Diego Forlán - 16 goals
  • Maxi - 8 goals
Top Goalkeepers
  • Christian Abbiati - 28 goals In 20 Matches
  • Leo Franco - 19 goals In 18 Matches

Atletico Madrid Recent History
SeasonPos.Pl.WDLGSGAPCupEurope
1996/1997542201111766471
ECLquarter-final
1997/1998738161210795660
UCsemi-final
1998/19991338121016545046FinalUCsemi-final
1999/2000193891118486438FinalUC4th round
2000/2001442211110593974


2001/200214223109684479


2002/20031138121115515647


2003/2004738151013515355


2004/20051138131114403450Semi-Final

2005/20061038131312453752last 16

2006/200773817912463960


2007/200843819711654464Quarter-FinalUCRound Of 32
2008/200911000003
UCL


Atletico Madrid Stadium Inforamtion
  • Name - Vicente Calderón
  • City - Madrid
  • Capacity - 54,851
  • Inauguration - 1966
  • Pitch size - 105 × 70 m




Labels:

NEWS: Martin Brodeur (Birthday 6th May), Famous Canadian Ice Hockey Player, New Jersey Devils, Martin Brodeur Career, Awards, Achievements

Martin Pierre Brodeur was born May 6, 1972, in Montreal, Quebec. Martin Brodeur was Canadian Ice hockey player. Martin Brodeur played entire National Hockey League career with the New Jersey Devils. Martin Brodeur was married Melanie Dubois in 1995. Martin Brodeur and Melanie Dubois have 4 children’s. Anthony was 1st son born in 1995, William and Jeremy was twins born in 1996, Martin Brodeur daughter Annabelle Antoinette was born in 2002. In 2003 Melanie Brodeur filed for divorce. In 2008 Martin Brodeur married his sister-in-law Genevieve Nault.

Martin Brodeur

Martin Brodeur

PositionGoaltender
Height
Weight
6 ft 2 in (1.88 m)
215 lb (98 kg/15 st 5 lb)
NHL TeamNew Jersey Devils
NationalityCanada
BornMay 6, 1972 (1972-05-06) (age 36),
Montreal, QC
NHL Draft20th overall, 1990
New Jersey Devils
Pro career1991 – present

Martin Brodeur was selected for Canada teams in 1998 winter Olympics, Japan but Martin Brodeur was not play in that Olympics. In 2002 Olympic Martin Brodeur was won Gold medal for Canada.

Martin Brodeur is
  • 4 time Vezina Trophy winner,
  • 4 time Jennings Trophy winner,
  • 10 time NHL All Star
Martin Brodeur has played for Canada in:
  • 1996 World Championship (Silver)
  • 1996 World Cup of Hockey (Lost Final)
  • 1998 Winter Olympic Games (4th place)
  • 2002 Winter Olympic Games (Gold)
  • 2004 World Cup of Hockey (Champions)
  • 2005 World Championships (Silver)
  • 2006 Winter Olympics (Lost Quarter-Final)
Martin Brodeur International Career Statistics
YearTeamEventGPW 543LTMINGASOGAA
1996CanadaWC3011140803.43
1996CanadaWCH201060404.00
1998CanadaOly0000000--
2002CanadaOly5401300901.80
2004CanadaWCH5500300511.00
2005CanadaWC75204192002.87
2006CanadaOly4220238802.01
Senior Int'l Totals26166214775412.19

Awards
  • QMJHL All-Rookie Team — 1990
  • QMJHL 2nd All-Star Team — 1992
  • Calder Memorial Trophy — 1994
  • NHL All-Rookie Team — 1994
  • Stanley Cup — 1995, 2000, 2003
  • Olympic Gold Medal — 2002
  • Primus World'Stars Challenge Bowl — 2004
  • World Cup of Hockey — 2004
  • NHL All-Star Game — 1996, 1997, 1998, 1999, 2000, 2001, 2003, 2004, 2007, 2008
  • William M. Jennings Trophy — 1997 (with Mike Dunham), 1998, 2003 (tied: Roman Cechmanek & Robert Esche), 2004
  • NHL 2nd All-Star Team — 1997, 1998, 2006, 2008
  • NHL 1st All-Star Team — 2003, 2004, 2007
  • Vezina Trophy — 2003, 2004, 2007, 2008

Labels:

Saturday, November 8, 2008

NEWS: Krispy Kreme is a is 70 years old doughnut store and a series of Krispy Kreme, Winston-Salem, North Carolina

About Krispy Kreme

Krispy Kreme is a is 70 years old doughnut store and a series of Krispy Kreme Doughnuts, Inc. located in Winston-Salem, North Carolina, US.

History & Founder

Vernon Rudolph was the founder of Krispy Kreme. Vernon’s uncle, Ishmael Armstrong, bought a secret recipe for yeast-raised doughnuts and a store from Joseph LeBeouf from Louisiana. Rudolph started selling the yeast doughnuts on his cycle for his uncle. Developed his business very well and joined his family members to meet the shoppers need.

Firstly Krispy Kreme store was situated in a rented construction on South Main Street in Winston-Salem in what is now called historic Old Salem.

In 1937, Rudolph opened a doughnut shop in Winston-Salem, and began selling to foodstuff and then straightaway to individual consumers.

1960s, Krispy Kreme was recognized all over the southeastern United States, and it expanded to other parts of the country.

In 1976, Krispy Kreme Doughnut Corporation become a wholly owned supplementary of Beatrice Foods of Chicago, Illinois.

Labels:

Sarah Palin (Birthday 11th February), Sarah Palin 2008 United States presidential election’s vice-presidential candidate, Biography of Sarah Palin

Sarah Palin was born on 11th February, 1964 in Sandpoint, Idaho, U.S. Sarah Palin in 2008 United States presidential election’s vice-presidential candidate for Republican Party.

Sarah Palin
SarahLouiseHeathPalin

Palin in Dover, New Hampshire, October 2008.

11th Governor of Alaska
Incumbent
Assumed office
December 4, 2006
LieutenantSean Parnell
Preceded byFrank Murkowski
Chairperson of the Alaska Oil and Gas Conservation Commission
In office
2003 – 2004
Preceded byCamille Oechsli Taylor
Succeeded byJohn K. Norman

Mayor of Wasilla, Alaska
In office
1996 – 2002
Preceded byJohn Stein
Succeeded byDianne M. Keller
Member of the
Wasilla, Alaska City Council
In office
1992 – 1996

BornFebruary 11, 1964 (1964-02-11) (age 44)
Sandpoint, Idaho, U.S.
Political partyRepublican
SpouseTodd Palin (since 1988)
ChildrenTrack, Bristol, Willow, Piper, Trig
ResidenceWasilla, Alaska
OccupationFormer local news sportscasting
Business
Commercial fishing
Politician
ReligionNon-denominational Christian
WebsiteAlaska Governor Sarah Palin

Labels:

NEWS: Grand Park, Downtown Chicago, Grand Park History, Grand Park History, Millennium Park, Museum Campus, Children’s Museum, Buckingham Fountain

Grand Park is located at Downtown Chicago. The Architect of Chicago is Burnham, D.H.; Bennett, Edward H. Grand Park was added to NRHP (U.S National Register of Historical Places) on July 21, 1993. NRHP Reference is 92001075 and government body is local.

GRAND PARK History:

Grand Park is a huge park of 319 acres or 1.29 Square kilometer in the loop community area of Chicago, Illinois, United States.

The unique idea for the town of Chicago left the area east of Michigan Avenue unsubsidized and vacant, and purchasers of Michigan Avenue plenty were promised that it would remain empty. After the former Fort Dearborn changed as the division of the town site (1839), the plat of the east area of Michigan Avenue south of Randolph was named "Public ground. Forever to remain empty of buildings."

GRAND PARK Features:

Millennium Park:

The northwestern place of the park was renovated in between 1998-2004 to develop into a neighboring park with a variety of imaginative facial appearance by some of the world's primary architects and artists. Millennium Park, the award-winning center for design of art, architecture landscape and music.

Daley Bicentennial Plaza:

The northeast place for the park hosts outdoor interests at Daley Bicentennial Plaza

Art Institute Of Chicago:

Art Institute of Chicago is located on the western edge of Grant Park, premier art museums and schools in the US, known specially for the extensive album of Impressionist and American art, such as Grant Wood's American Gothic.

Buckingham Fountain:

Buckingham Fountain, one of the largest fountains in the world. It Located in the middle of Grant Park. In 1927 Buckingham fountain was dedicated as a gift to the city from Kate Sturges Buckingham in remembrance of her brother Clarence Buckingham. The fountain runs with a water and light display during 21:00-22:00. While warm-weather months

Museum Campus:

Chicago's Museum Campus (57 acre (230,850 m²) is located on the southern end of the Grant Park's.

Children's Museum:

$100 million Children's Museum worth New Plans that will shift from Navy Pier to Grant Park. Children’s Museum was approved by Richard M. Daley


Labels:

NEWS: Brady Quinn (Birthday 27th October), Famous America Football Player, Brady Quinn Football Career, Career Highlights and Awards, Career Statistic

Brady Quinn is American football player. Brady Quinn born on October 27, 1984 in Columbus, Ohio. Brady Quinn Professional debut 2007 for the Cleveland Browns.

Brady Quinn
Brady Quinn
Cleveland Browns — No. 10
Quarterback
Brady Quinn Date of birth: October 27, 1984 (1984-10-27) (age 24)
Brady Quinn Place of birth: Columbus, Ohio
Height: 6 ft 3 in (1.91 m)Weight: 235 lb (107 kg)
Brady Quinn Professional debut
2007 for the Cleveland Browns
Brady Quinn Career history
College: Notre Dame
NFL Draft: 2007 / Round: 1 / Pick: 22
Teams:
  • Cleveland Browns (2007-present)
Brady Quinn Roster status: Active
Brady Quinn Career highlights and awards
  • Sammy Baugh Trophy (2005)
  • Johnny Unitas Golden Arm Award (2006)
  • Maxwell Award (2006)
  • Cingular All-America Player of the Year (2006)
  • MSNBC Most Valuable Player (2006)
Selected NFL statistics
(through Week 10 of the 2008 NFL season)
TD-INT 2-0
Passing yards 284
QB Rating 95.5

Statistics

College:

YearPassingRushing
CMPATTYDSCMP %YPALNGTDINTSKRATATTYDSAVGLNGTDFDFUMLST
2003157332183147.35.52859151393.5248250.5150000
2004191353258654.17.3354171025125.8754-4-0.1223000
2005292450391964.98.718032720158.4070901.3161000
2006289467342661.97.346237731146.6582710.9602000
Totals92916021176259.97.3485953989134.402541820.7226000

Labels:

Friday, November 7, 2008

NEWS: Melbourne Cup, Melbourne Cup Race information, Melbourne Cup Results and Melbourne Cup records, Most Wins, jockey, AAMI Victoria Derby Day

Melbourne Cuo Group I race
Melbourne Cup

Engraving the finish line at the 1881 Melbourne Cup
LocationFlemington Racecourse
Melbourne, Australia
Inaugurated1861
Race typeThoroughbred - Flat racing
WebsiteFlemington Racecourse
Melbourne Cup Race information
Distance3200 metres (1.988 miles, 16 furlongs)
TrackTurf, left-handed
QualificationThree-year-olds and up
WeightHandicap
PurseAUD$5.5 million (about USD$3.4 million)
BonusesAUD$500,000 bonus to thewin of Melbourne Cup and in the Ireland Irish St. Leger also held in the same year at Curragh Racecourse.

The Melbourne Cup carnivalrace days in 2008:

  • Saturday 1st November – AAMI Victoria Derby Day
  • Tuesday 4th November – Emirates Melbourne Cup Day
  • Thursday 6th November – Crown Oaks Day
  • Saturday 8th November – Emirates Stakes Day

Related Info On Melbourne Cup:

  • Melbourne Cup: Biggest Event in Australian Racing
  • Melbourne Cup Day
  • The Running of the Melbourne Cup
  • Melbourne Cup 2007
  • Melbourne Cup Photo Gallery
  • Melbourne Cup Tickets & Dinning
  • Melbourne Cup Seasons, Style & Fashion
  • Melbourne Events Guide
  • Visiting Melbourne
  • Melbourne Cup Business Network
  • Melbourne Cup Racing news & Information
  • Travel Packeges for Melbourne

Results and records

2007 Melbourne Cup, Derby Day
Most wins:

  • 3 - Makybe Diva (2003, 2004, 2005)
  • 2 - Archer (1861, 1862)
  • 2 - Peter Pan (1932, 1934)
  • 2 - Rain Lover (1968, 1969)
  • 2 - Think Big (1974, 1975)

Most wins by an owner:

  • 4 - Etienne L. de Mestre (1861, 1862, 1867, 1878)
  • 4 - John Tait (1866, 1868, 1871, 1872)
  • 4 - Dato Tan Chin Nam (1974, 1975, 1996, 2008)

Most wins by a jockey:

  • 4 - Bobby Lewis (1902, 1915, 1919, 1927)
  • 4 - Harry White (1974, 1975, 1978, 1979)

Most wins by a trainer:

  • 12 - Bart Cummings (1965, 1966, 1967, 1974, 1975, 1977, 1979, 1990, 1991, 1996, 1999, 2008)
  • 5 - Etienne L. de Mestre (1861, 1862, 1867, 1877, 1878)
  • 5 - Lee Freedman (1989, 1992, 1995, 2004, 2005)

Fastest recorded time: 3:16.3 - Kingston Rule (1990

Melbourne Cup Attendance

  • 2008 - 107,000
  • 2007 - 102,411
  • 2006 - 106,691
  • 2005 - 106,479
  • 2004 - 98,181
  • 2003 - 122,736 (record)

Labels:

EVNTS: All Saints Day (1st November), All Saints Day History, Activities,All Saints Day Celebrations, All Saints Day 2009 and All Saints Day Festival

All Saints Day 1st November

The Feast of All Saints is a sacred day of the Church worshiping all saints, recognized and unidentified. This is a great deal like the American holidays Veterans Day and Presidents Day, where a lot of public are delighted on one day. While we have acquaintance of many saints, and we tribute them on exact days, there are many unidentified or unsung saints, who may have been forgotten, or never been particularly honored. On All Saints Day, we rejoice these saints of the Lord, and ask for their prayers and arbitrations. The whole notion of All Saints Day is tied in with the thought of the Communion of Saints. This is the faith that all of God's populace, on heaven, earth, and in the condition of purification (called Purgatory in the West), are associated in a communion. In extra words, Catholic and Orthodox Christians consider that the saints of God are just as living as us, and are continually intervene on our behalf. Keep in mind, our relationship with the saints in heaven is one grounded in a tight-knit spir
itual union.

There are thousands of canonized saints, i.e. those persons formally recognized by the Church as holy men and women admirable of imitation. Since miracle have been linked with these people, and their lives have been fully inspected and found holy by the Church, we can be certain they are major illustrations of sanctity, and influential intercessors before God on our behalf. There are also many supporter saints, guardians or guardians of different regions and states of life. For example, St. Vitus is the supporter saint against oversleeping, and St. Joseph of Cupertino is the supporter saint of air travelers. It may sound wild to have a patron saint against oversleeping, but keep in mind the Church has something significant for each region of our human lives. All of these saints are renowned all throughout the year, as many have their individual feast days

All Saints Day History

All Saints Day is when the Church honors all saints, famous and strange. The eve of All Saints is recognized as All Hallows Eve, or Halloween. All Saints Day is November 1

Christians have been adoring their saints and martyrs from the time when the second century AD. The Martyrdom of Polycarp, almost certainly written near the middle of the second century, confirm to this reality:

At first the date book of saints and martyrs wide-ranging from site to site, and many times local churches honored neighboring saints. On the other hand, steadily feast days turn into more widespread. The first indication to a common banquet celebrating all saints occurs in St Ephrem the Syrian (d. AD 373). St. John Chrysostom (d. AD 407) allocates a day to the feast, the first Sunday after Pentecost, where in the Eastern Churches the feast is notable to this day. In the West, this date was perhaps originally used, and then the banquet was moved to May 13th. The existing ceremony (November 1) possibly commenced from the time of Pope Gregory III (d. AD 741), and was likely first implemented on November 1st in Germany.

The vigil of the Feast (the eve) has matured up in the English talking countries as a celebration in itself, All Hallows Eve, or Halloween. While a lot of people consider Halloween pagan (and in many occurrence the celebrations are for many), as far as the Church is concerned the date is just the eve of the feast of All Saints. Many traditions of Halloween imitate the Christian faith that on the feast's vigils we ridicule evil, because as Christians, it has no genuine power over us. Nevertheless, for a number of people Halloween is used for vice motives, in which many Christians experiment innocently. David Morrison clarifies the proper association between Christians and Halloween. A variety of traditions have developed associated to Halloween. In the Middle Ages, poor people in the society requested for "soul cakes," and ahead receiving these doughnuts, they would agree to plead for dead. The tradition of masks and outfits developed to mock evil and maybe perplex the evil spirits by dressing as one of their own. Some Christians visit graveyard on Halloween, not to practice evil, but to honor departed relatives and friends, with picnics and the last flowers of the year. The day after All Saints day is called All Soul's Day, a day to memorize and offer prayers up on behalf of all of the truthful departed. In many civilizations it seems the two days share many customs.

Labels:

EVENTS: Black Friday, Black Friday History, 28th November Black Friday 2008, Black Friday, Back Friday sale ads 2008, Back Friday shopping 2008

Black Friday 2008 - 28th November

Black Friday Online Shopping
Black Friday Deals
Black Friday Deals 2008
Black Friday 2008 Best Buy
Black Friday 2008 Dates
Black Friday 2008 Target



Black Friday is the concession shopping day that trail American Thanksgiving, which is for all time on a Thursday. Merchants uphold Black Friday as the day to begin shopping for Christmas. Black Fridays frequently promoted with "Christmas Sales" in addition to "Thanksgiving Sales."


Black Friday History
The record of Black Friday subsequent to the Thanksgiving Day being the authorized start of the festival shopping season is connected together with the thought of Santa Claus processions. They are fused with a parade have a good time on Thanksgiving Day. These parades, though mainly a festivity of thanksgiving, include an emergence of Santa at the ending with the thought that 'Santa has arrived'.
In the late 19th century and early 20th century, Thanksgiving Day parades were supported by merchant stores. These consist of the Toronto Santa Claus Parade funded by Eaton's and the Macy's Thanksgiving Day Parade paid for by Macy's. Department stores would make use of the parades to initiate a big publicity thrust. In due course it just turn into a traditional statute that no store would seek doing Christmas promotion before the carnival was over. Therefore, the day after Thanksgiving developed into the day when the shopping period formally started.


In 1869 a small group of American financial speculators, including Jay Gould and James Fisk, required the support of federal officials of the Grant administration in a drive to corner the gold market. The effort was unsuccessful when administration gold was released for sale. The drive concluded on a Friday, when thousands were insolvent—the day is popularly called Black Friday. There was great annoyance against the perpetrators. Several other days of financial panic have also been irregularly referred to as Black Friday.
Proceedings of Black Friday
The word "black" in Black Friday refers to the expression "in the black" implying making a profit. Today, Black Friday is not a vital cause of earnings to retailers, but is significant in pouring traffic into stores. A lot of sellers mail unique Black Friday circulars to consumers publicizing extremely cut-rate items in the anticipation that consumers will visit their store on Black Friday.
Marketing studies have shown that many Black Friday customers will buy other products from stores in which they intended to visit to buy advertised items. The amplified volume of shoppers purchasing non-discounted stuff makes Black Friday money making for retailers even though they do not make a great deal of profit on extremely discounted products.

While some people move out on a Black Friday for just window shopping, others persist they will not shop on a Black Friday at all, quoting congested parking lots and wall-to-wall shoppers as cause to give up saving money at sales. Yet many others not only decided with which products they will purchase from which stores, they are prepared to bold extensive lines to get good deal on items they want. Each year, Black Friday has so many concerned shoppers chipping in that it remnants a retailing custom in the United States.


Electronics and toys are well liked Christmas gifts and are time and again the most sought after negotiating product during Black Friday shopping outing. Retailers frequently cut prices on the most recent electronics and toys by as much as half or even one third of their recommended retail price. Retailers are aware of the fact that consumers will react to such massive chance to save on Christmas shopping costs. Jewelry is a further popular product Black Friday item that shoppers look for decrease on, although extremely large concession on jewelry items are not typically as general as significantly reduced prices on toys and electronics are.

As provisions of deeply low priced goods are frequently limited by vendors, "door buster" sales are ordinary on a Black Friday. The people who turn up in the early hours to line up closest to the store's front doors are the only ones certain to be able to buy the advertised products if the store runs out. To help recompense for this, a large number of stores attempt to have as many of each thing as doable and/or state the amount available on their circular. Some stores also give out inducement prizes to those in line such as gift cards good for free products in the store to the first hundred or extra shoppers.

When Black Friday?

Black Friday - Friday, November 28, 2008
Black Friday - Friday, November 27, 2009
Black Friday - Friday, November 26, 2010
Black Friday - Friday, November 25, 2011
Black Friday - Friday, November 23, 2012
Black Friday - Friday, November 29, 2013

What is Black Friday?

The day after Thanksgiving Day in USA, referred as Black Friday. Black Friday is Major US Holiday and shopping Day. Black Day is known as 1st Shopping day of Christmas.

Retailers are published Black Friday sale ads in the newspaper on Thanksgiving Day (The day before Black Friday)

Labels:

Wednesday, November 5, 2008

BIRTHDAYS: Christopher Knight (Birthday 7th November), Famous American Actor, Biography of Christopher Knight on Career, Personal Life, Achievements

Christopher Anton Knight an American artist was born on 7th November, 1957 in Manhattan, New York. Christopher Knight is popular for playing the Peter Brady on 1970s series, The Brady Bunch. Christopher Knight became a victorious businessman. Christopher Knight has enjoyed the semi-resurgence in the community eye with the current TV appearances. Christopher Knight has also been spouted to host Trivial Pursuit: America Plays opening in fall of 2008. And his father, Edward Knight, is also an artist.

Biography of Christopher Knight

When Christopher Knight was seven years old, Christopher Knight started acting in commercials for Toyota and Tide, and emerged in TV shows for instance Mannix and Gun smoke. Christopher Knight popular character was as the Peter in iconic sitcom The Brady Bunch, while Christopher also emerged in Nowhere, That 70s Show, Happy Days, Fallen Angels, and the Bionic Woman. Besides acting, Christopher Knight has worked with computer industry and also information equipment, co-founding and also supervising companies for instance Eskape Labs, Integral Micro Solutions and Visual Software. Christopher Knight also maintains a sporty physique and Christopher Knight has endorsed exercise product for the Abs Lounge.

Christopher Knight Current Career

In 1988, Christopher Knight’s interest in machines and science led him in computer industry. Christopher Knight icon status supported him to polish skills in marketing and sales. Christopher Knight became an account sales manager at the Martec, Inc. and within his initial 18 months, Christopher Knight registered the company’s earliest US$1 million sales order. And after it, Christopher Knight became the Martec's best performer, and also worker of the year.

Christopher Knight came back to his Brady roots in 1988 Brady Christmas film, A Very Brady Christmas.

In the year of 1989, Christopher Knight became the vice president of devise system advertising and sales at the New Image Industry, stirring the corporation into 3D rendering/imaging equipments. And in the mid of 1991, Christopher and other workers effectively stirred the software engineering team and 3D technologies into the novel privately detained company, Visual Software. And as the co-founder of visual Software, Christopher Knight was a premature contributor in purchaser 3D graphics market. And his hard work led to the business achievement. Visual Software was obtained through Micrograph in January.

In the year of 1996, Christopher Knight became vice president of marketing at Adesso, a CPU keyboard manufacturer.

In 1998, Christopher Knight and his friend Paniagua and also an associate David Smith, made the Eskape Labs. With an assignment to provide "on wire" digital uses that simply plug into computer, Eskape has expanded many first-to-market video procedures. The company was acquired through Hauppauge Computer Works in 2000. And Hauppauge is considered the world's prime manufacturer of PC based TV tuner products and, also with Eskape Labs, now it has the line of TV tuners that are Macintosh attuned.

Revisit to Television

Christopher Knight emerged on the particular chapter of The Weakest Link TV show that attributed the shed of Brady Bunch resolution against each other. At the last, Christopher Knight succeeded in the show with ensue going to his elected charity.

Enduring to follow television opportunities, Christopher Knight merged on the VH1’s 4th season of The Surreal Life. For the period of his show, Christopher Knight began romance with a model Adrianne Curry, conqueror of the America's next top model cycle 1,and who is about 25 years younger than Christopher Knight. And when the show finished, they got engaged, as familiar on VH1 series My Fair Brady, which premier on 11th September, 2005. And the sequence was renewed for one more season. And they wedded on 29th May, 2006 in Gothic mode wedding.

Christopher Knight was also attributed in the music video for cluster Click Five for a song "Just the Girl", in which Christopher Knight played a high school trainer. Christopher Knight also emerged in Click Five's music video for "Catch Your Wave" as a hotel supervisor.

Christopher Knight and his earlier Brady Bunch co-star Barry Williams emerged in 2006 chapter of That '70s Show. They played the role of gay couple who shifted in the next door. They remained best friends since Brady Bunch days; Williams emerged many times on My Fair Brady. And in single episode, Christopher Knight uttered for his spouse, model Adrianne Curry, that it was very important to admit his deep connection with his earlier Brady Bunch co-stars.

Christopher Knight was a contributor in VH-1's I Love The '70s: Volume II mini series. Christopher Knight and his friends and family emerged on period finale on the NBC’s Celebrity Family Feud on 29th July, 2008.

Quote

“It may part of a one way evolution... or it may be we are currently on the downside of an innocence cycle where one day, with an up cycle, sweet will be entertaining again.”

BIRTHDAYS: Ethan Hawke (Birthday 6th November), Famous American Actor, Biography of Ethan Hawke on Career, Personal Life, Awards & Achievements

Name : Ethan Hawke
Birth Name : Ethan Green Hawke
Ethan Hawke Height : 5' 10
Sex : Male
Nationality : American
Ethan Hawke Birth Date : 6th November 6, 1970
Ethan Hawke Birth Place : Austin, Texas, USA
Profession : Novelist, Actor
Ethan Hawke Education : West Windsor-Plainsboro High School in New Jersey (1984-1986)
Ethan Hawke Wife : Uma Thurman (wedded on 1st May, 1998; separated on 20th July, 2004)
Ethan Hawke Daughter : Maya Ray Thurman-Hawke (born on July 8, 1998)
Ethan Hawke Son : Roan (born on January 15, 2002)
Claim to fame : played Todd Anderson in Dead Poets Society (1989)

Ethan Green Hawke a film director, writer and American actor was born on 6th November, 1970 in Austin Texas.

Biography of Ethan Hawke

Ethan Hawke Childhood

Ethan Hawke was the son of James Steven Hawke and Leslie Carole. When Ethan Hawke was 5 years old, his parents separated with each other. At the age of ten, Ethan Hawke shifted with his mother from Atlanta to New York, at where Ethan Hawke joined the Packer Collegiate Institute in Brooklyn Heights and after it Ethan Hawke shifted to the West Windsor, New Jersey, at where Ethan Hawke focused what is currently West Windsor-Plainsboro High School South. Ethan Hawke got the degree of graduation from the Hun School of Princeton in 1988. Ethan Hawke took the acting classes at McCarter Theatre. When Ethan Hawke was 12 years old, Ethan Hawke did primary salaried role in McCarter's making of George Bernard Shaw's Saint Joan.

Ethan Hawke Career Graph

When Ethan Hawke was 14 years old, Ethan Hawke formed his feature movie debut in Joe Dante's Explorers (1985). Ethan Hawke taught acting at British Theatre Association in England and also at Carnegie Mellon University in Pittsburgh. Ethan Hawke is one of the origin fathers and creative executive of Malaparte, a previous New York City theatre company. And Malaparte productions comprised Sons and Fathers, Veins and Thumbtacks, The Great Unwashed, Good Evening, It Changes Every Year, Wild Dogs, Hash, and A Joke.

In the year of 1988, Ethan Hawke was directed in a character in administrator Peter Weir's Dead Poets Society; and the success of the movie was considered his get through. Ethan Hawke left his school and emerged in Disney's White Fang, Reality Bites, Gattaca, Great Expectations, Before Sunrise, The Newton Boys, Alive, A Midnight Clear, and also many additional movies. And in the year of 2001, Ethan Hawke was selected for the Screen Actors Guild Award for the Best Supporting Actor and also an Academy Award for Best Supporting Actor for his character in Training Day. Ethan Hawke directed the Chelsea Walls and also has written 2 narratives, The Hottest State (in 1996) and Ash Wednesday (in 2002). And in the year of 2005, Ethan Hawke achieved his initial screenwriting Oscar recommendation for co-writing 2004 movie, Before Sunset (a continuation to Before Sunrise). And from October 2006 till May 2007, Ethan Hawke was in The Coast of Utopia through Tom Stoppard at the Lincoln Center in New York, playing Mikhail Bak
unin. And for this presentation, Hawke was selected for Tony Award for the Best Featured Actor in a Play.

On 26th March, 2006 Ethan Hawke private trade office in New York City was ruined through fast moving fire. Ethan Hawke was in the mid of starring and directing in a film edition of his initial novel, The Hottest State. Because of fire Ethan Hawke had lost his 4th floor office and also post production studio. In summer of 2006, Ethan Hawke emerged in Sidney Lumet-directed movie Before the Devil Knows You're Dead with Philip Seymour Hoffman, Albert Finney, and Marisa Tomei. Ethan Hawke directed The New Group's world first performance of Jonathan Marc Sherman's drama Things We Want which started previews 22nd October, 2007.

Ethan Hawke Private Life

In the month of May of 1998, Ethan Hawke wedded with the actress Uma Thurman. They have two kids, son- Roan and daughter Maya Ray Thurman. And after six years, Ethan Hawke eventually divorced her.

Ethan Hawke lives in Chelsea, a district in the region of Manhattan in New York City, and also has a petite island in Tracadie, Nova Scotia. Recently Ethan Hawke has finished a script with Tracadie fellow citizen, writer Charles Gaines, dramatist of Pumping Iron and originator of diversion paintball.

Ethan Hawke is Democrat. Ethan Hawke has sustained John Kerry for the President of the United States in 2004 and also Barrack Obama for 2008.

Filmography of Ethan Hawke

YearTitleRoleNotes
1985ExplorersBen Crandall
1989Dead PoetsSocietyTodd Anderson
Lion's DenUnnamed
DadBilly Tremont
1991Mystery DateTom McHugh
White FangJack Conroy
1992Water landMathew Price
A Midnight ClearWill Knott
1993Rich in LoveWayne Frobiness
Alive: TheMiracle of the AndesNando Parrado
Reality BitesTroy Dyer
1994FlounderingJimmy
Before SunriseJesse Wallace
1995GattacaVincent Anton Freeman/Jerome Morrow
1997The Newton BoysJess Newton
1998GreatExpectationsFinnegan 'Finn' Bell
Snow Fallingon CedarsIshmael Chambers
1999HamletHamlet
2000Training DayJake Hoytoscar nominated
2001TapeVince
Waking LifeJesse Wallace
Before SunsetJesse Wallace
2004Taking LivesJames Costa
Lord of WarAgent Jack Valentine
2005Assault onPrecinct 13Sgt. Jake Roenick
Fast FoodNationPete
2006The HottestStateVince
Before theDevil Knows You're DeadHenry "Hank" Hanson
2007Tonight at NoonLeftyawaiting release
2008What Doesn'tKill YouPaulieawaiting release
Day breakersUnnamed researcherpost-production
Staten IslandUnnamedpost-production
New York, I Love YouTBAawaiting release
2009Brooklyn's FinestSalfilming
2013BoyhoodUnnamedfilming

Bibliography
  • Ash Wednesday (2002)
  • The Hottest State (1997)

BIRTHDAYS: Ryan Adams (Birthday 5th November), Famous American Musician, Biography of Ryan Adams on Career, Personal Life, Awards & Achievements

David Ryan Adams American alt-country/rock singer-songwriter was born on 5th November, 1974 in Jacksonville, North Carolina. Ryan Adams grew up through his mother and grandmother. When Ryan Adams was 16 years old, Ryan Adams left of school and presented with various confined bands before shifting to Raleigh and producing a band Whiskey town. In the year of 2000, Ryan Adams released Heartbreaker. Ryan Adams became popular for his song "New York, New York", in which Ryan Adams emerged on his release Gold in the year of 2001. Since Ryan Adams has released four additional unaccompanied albums and also 3 albums with his supportive band, The Cardinals. And Ryan Adams newest release, Cardiology, was unconfined on 28th October, 2008.

Ryan Adams has also formed albums through Willie Nelson and Jesse Malin and added to the albums of the artists, comprised: The Wallflowers, Minnie Driver, Beth Orton, Jesse Brand, Counting Crows, Cowboy Junkies, America and Toots and the Maytals. Adams also emerged on the CMT's Crossroads with Elton John.

Biography of Ryan Adams

Ryan Adams Early Life

Ryan Adams was the son of Robert and Susan Adams. At the age of 9, Ryan Adams father departed from home. Ryan Adams mother, an English educator, supported Ryan Adams to read. And after some time, Ryan Adams became recognizable with the occupations of authors comprised Edgar Allan Poe, Henry Miller, Sylvia Plath and Jack Kerouac.

At the age of 8, Ryan Adams began writing poetry and short stories on the typewriter of his grandmother. Adam is quoted as uttering, "I started writing short stories when I was really into Edgar Allan Poe. Then later, when I was a teenager, I got really hard into cult fiction: Hubert Selby, Jr., Henry Miller, and Jack Kerouac,” and when Ryan Adams was 14 years old, Ryan Adams started learning the stimulating guitar and after some time, Ryan Adams joined the local band called Blank Label.

Ryan Adams left high school in his 10th grade, and shifted into Jere McLean’s hire house just exterior Jacksonville. At present, Ryan Adams performed temporarily with 2 local bands, The Lazy Stars and Ass. Subsequently, Ryan Adams attached with The Patty Duke Syndrome, and formerly played in bar in Jacksonville. And after getting his GED, Ryan Adams left Jacksonville for the Raleigh, followed by band mate Jere McLean. And The Patty Duke Syndrome divided in 1994, subsequent releasing a 7" single containing two songs (The Patty Duke Syndrome was on single side, while additional side was the band called Glamour Puss).

Ryan Adams Career Graph

Whiskey Town

Following the fragment of The Patty Duke Syndrome, Ryan Adams gave the last touch to establish Whiskey town with Phil Wandscher, Caitlin Cary, Steve Grothmann and Eric "Skillet" Gilmore. The beginning of Whiskey town noticed Ryan Adams shift to alt-country, depicting punk rock as "too hard to sing" in label track of the Whiskey town’s unveiling album Faithless Street. And Whiskey town was deeply influenced through country-rock pioneers, most remarkably Gram Parsons. Whiskey town swiftly achieve critical acclamation with the discharge of their IInd complete album, Stranger's Almanac, their primary major label release.

Pneumonia was the primary of numerous associations between Ryan Adams and creator Ethan Johns. And the releasing of Pneumonia was delayed awaiting 2001 owing to authorized problems trunking from the fusion of Universal and PolyGram.

Ryan Adams Solo Career

Ryan Adams created his solo presentation in the year of 2000, with the Heartbreaker. In the year of 2001, Ryan Adams released Gold, an extensive 16-song album with a partial version 5- songs bonus disc. Ryan Adams achieved two Grammy Award selection in 2002; "Best Male Rock Vocal" for “Best Rock Album", “New York, New York". Ryan Adams also obtained a recommendation the equal year for the "Best Male Country Vocal" for his edition of Hank Williams' "Lovesick Blues" from homage album Timeless. And Gold's "When the Stars Go Blue" has been enclosed by Bono and The Corers, Tim McGraw and Tyler Hilton.

In May 2002, Ryan Adams tied with Elton John on CMT's Crossroads, which convey mutually country artists with the musicians from additional genres. From the period of the show, John submitted to Ryan Adams as the "fabulous one". At the same year, Ryan Adams allegedly recorded a wrap of The Strokes' unveiling album Is This It, while it hasn’t been openly released.

For the period of 2002-03 Ryan Adams worked up recording Love Is Hell, planning to liberate it on 2003. After two weeks, Ryan Adams came back to Lost Highway with the Rock n Roll, which attributed guest musicians comprised Green Day's Billie Joe Armstrong, Melissa Auf der Maur, and his girlfriend at the moment, Parker Posey.

The Cardinals

Ryan Adams attached with supportive band The Cardinals to make two albums, Cold Roses and Jacksonville City Nights. A double album, Cold Roses, included supportive vocals from the Rachael Yamagata on the three songs; "Cold Roses" and "Let It Ride", "Friends". And Ryan Adams second one album Jacksonville City Nights featured a duet with the Norah Jones on "Dear John". Besides his two albums Ryan Adams also released the single album 29.

Ryan Adams formed Willie Nelson's album Songbird, whereas Ryan Adams and Cardinals presented as the Nelson’s supportive band. And the album was on the loose in October, 2006. At the same year, Ryan Adams experimented with the hip-hop music, totaling to his web site 18 albums merit of novel recordings under a variety of pseudonyms, attributing nonsensical and humorous lyrics.

On 23rd October, 2007, Ryan Adams unconfined Follow the Lights, an EP attributing three latest songs: "My Love For You Is Real", "Blue Hotel", and "Follow The Lights", with the live studio editions of additional formerly released songs. Ryan Adams also emerged as the guest musician on the Cowboy Junkies' 2007 album and also DVD Trinity Revisited, 20th-anniversary re-recording of their usual album The Trinity Session.

A latest album with the Cardinals, Cardiology was on the loose on 28th October, 2008. Ryan Adams has also declared plans to discharge a manuscript, entitled Infinity Blues.

Discography of Ryan Adams
  • 2000: Heartbreaker
  • 2001: Gold
  • 2002: Demolition
  • 2003: Rock N Roll
  • 2004: Love Is Hell
  • 2005: Jacksonville City Nights (with The Cardinals)
  • 2005: Cold Roses (with The Cardinals)
  • 2005: 29
  • 2007: Easy Tiger (with The Cardinals, but billed as solo)
  • 2008: Cardiology (with The Cardinals)
Bibliography
  • Infinity Blues (2009)

Sunday, November 2, 2008

BIRTHDAYS: Matthew McConaughey (Birthday 4th November), Famous American Actor, Biography of Matthew McConaughey on Career, Personal Life, Achievements

Matthew David McConaughey an American artist was born on 4th November, 1969 in Uvalde, Texas. After a sequence of slight roles in early 1990s (comprised his getaway role in Dazed and Confused (1993), executive Richard Linklater's second feature film), Matthew McConaughey emerged in movies for instance A Time to Kill (1996), Contact (1997), U-571 (2000), Sahara (2005), and We Are Marshall (2007). Matthew McConaughey played the role of leading man in various romantic comedies, comprised The Wedding Planner (2001), How to Lose a Guy in 10 Days (2003), Failure to Launch (2006), and Fool's Gold (2008).

Biography of Matthew McConaughey

atthew McConaughey Early life

Matthew McConaughey was the son of James Donald McConaughey, a gas station proprietor and Mary Kathleen "Kay" (née McCabe), an alternate school teacher. Matthew McConaughey father also played football for Green Bay Packers.

Matthew McConaughey shifted to Longview, Texas. Matthew resided for 1 year in Gorokan, New South Wales, Australia as the Rotary exchange student.

Matthew McConaughey Career Graph

Matthew McConaughey started his acting career in 1991, emerging in student movies and TV commercials while joining the College of Communication at The University of Texas at Austin before being cast in Richard Linklater's film Dazed and Confused (1993). During this time, Matthew McConaughey played the negligent boyfriend in the country vocalist Trisha Year wood’s video "Walk away Joe". And after emerging in some extra small parts in Boys on the Side, Texas Chainsaw Massacre: The Next Generation, Angels in the Outfield, and TV series Unsolved Mysteries.

Matthew McConaughey was directed in main roles in much more films: Amistad, Edtv, U-571, The Newton Boys, and Contact. By early 2000s, Matthew McConaughey was regularly directed in romantic comedies, consists of How to Lose a Guy in 10 Days, and The Wedding Planner, both were flourishing at box office. Throughout this period, Matthew McConaughey emerged as firefighter in low-budget movie Tiptoes, contrary Rene Russo, in Two For The Money as a reliant to the Al Pacino's gambling tycoon, and also in Frailty, directed against type as the serial killer, opposed Bill Paxton.

Matthew McConaughey also starred in feature movie Sahara (budgeted at $130 million), with Penelope Cruz and Steve Zhan. Before the release of the film, Matthew McConaughey endorsed it through repeating some tours Matthew McConaughey took in late 1990s, comprised sailing down Amazon River and trekking to Mali. And that equal year, Matthew McConaughey was called People magazine's “Sexiest Man Alive” for 2005.

In the year of 2006, Matthew co-starred with the Sarah Jessica Parker in romantic comedy Failure to Launch, which was logically successful at box office. Matthew McConaughey provided voice occupation for a trailer campaign of Peace Corps in late 2006. Matthew McConaughey production corporation, j.k. livin, is presently in progress on assignments with the Paramount Pictures, Universal, Imagine Entertainment and Warner Bros., and can recently be seen in football play We Are Marshall. Matthew McConaughey is allegedly in row to star as Thomas Magnum in 2009 show Magnum, P.I. Matthew McConaughey also emerged in Ben Stiller's Tropic Thunder, swapping Owen Wilson for the position.

On 21st January, 2008, Matthew McConaughey became new orator for nationwide radio campaign, "Beef: It's What's For Dinner".

Matthew McConaughey Personal life

Matthew McConaughey personal slogan is "Just Keep Livin”. Matthew McConaughey foundation is named JK Livin Foundation. And JK Livin Foundation's focal point is to aid youngster live “fuller” lives. And on 24th October, 1999, Matthew McConaughey was detained at his home in Austin, Texas on the charges of ownership of marijuana and resisting detain. In accordance with police reports, Matthew McConaughey was dancing around nude and also playing the bongo drums with a companion, actor Cole Hauser, and a co-actor in Dazed and Confused (1993). And the drug indicts were went down, but Matthew McConaughey pled responsible for defying the city’s noise regulation and paid the USD $50 fine.

Matthew McConaughey rescued diverse pets, including hamsters, dogs and cats, which were trapped after the overflowing of New Orleans from Hurricane Katrina.

Matthew McConaughey private life is the topic of media awareness. Matthew McConaughey has dated with actresses Ashley Judd, Penelope Cruz, Kate Hudson, Sally Richardson, and Sandra Bullock.

Matthew McConaughey Brazilian girlfriend Camila Alves, gave birth a son named Levi Alves McConaughey on 7th July, 2008 in Los Angeles.

Filmography of Matthew McConaughey

YearTitleRoleNotes
1993MyBoyfriend's BackTeenage Moviegoer$3,335,984
1993Dazed andConfusedDavid Wooderson$7,993,039
1994Angels in theOutfieldBen Williams$50,236,831
1995Texas Chainsaw Massacre: The NextGenerationVilmer$141,626
Boys on theSideOfficer Abe Lincoln$23,450,000
1996A Time toKillJake Tyler Brigance$108,706,165
Lone StarBuddy Deeds$13,269,963
Glory DazeRental Truck Guy
Larger ThanLifeTip Tucker$8,289,972
ScorpionSpringEl Rojo
1997AmistadBaldwin$44,175,394
ContactPalmer Joss$100,853,835
1998The Newton BoysWillis Newton$10,297,897
1999EdtvEd 'Eddie' Pekurny$22,362,500
2000U-571Lt. Andrew Tyler, Executive Officer$77,086,030
2001The WeddingPlannerSteve "Eddie" Edison$60,400,856
2002Reign of FireDentonVan Zan$43,061,982
ThirteenConversations About One ThingTroy$3,287,435
FrailtyAdam Meiks$13,103,828
2003How to Lose AGuy in 10 DaysBenjamin 'Ben' Barry$105,807,520
2004PaparazziHimself$15,712,072
2005Two for theMoneyBrandon Lang$22,862,049
SaharaDirk Pitt$68,642,452
2006We Are MarshallJack Lengyel$43,532,294
Failure toLaunchTripp$88,658,172
2008Fool's GoldBen 'Finn' Finnegan$70,224,196
TropicThunderRick PeckStill In Theatres
Surfer DudeSteve AddingtonAwaiting release
2009The Ghosts ofGirlfriends PastConnorPost-Production
Hammer DownTBAAnnounced

BIRTHDAYS: Dennis Miller (Birthday 3rd November), Famous American Comedian, Biography of Dennis Miller on Career, Personal Life, Awards & Achievements

Name: Dennis Miller
Profession: Comedian
Dennis Miller Birth Details: born 3rd November, 1953 in Pittsburgh
Dennis Miller Height: 5' 9" (1.75 m)
Personal quotes: "When it comes down to it, we're really just a big ant farm with beepers."
"America may be the best country in the world, but that's Ki Spouse: Ali Epsley (10 April 1988 - present) 2 children

Dennis Miller a political/sports reporter, American comedian and television/radio personality was born on 3rd November, 1953 in Pittsburgh, Pennsylvania. Dennis Miller grew to fame as the cast associate of Saturday Night Live in late 1980s. Subsequently Dennis Miller hosted the filament of the chat shows on HBO, CNBC and also in syndication. At present Dennis Miller hosts daily, 3 hour, self titled converse radio program, nationwide syndicated through Westwood One.

In current years, Dennis Miller has become identified for his conventional political opinions, highlighting a hawkish posture on the U.S. military deed and confrontation for the Republican presidential applicants. Dennis Miller is a usual political reviewer on the Fox News Channel's The O'Reilly Factor in the fragment called "Miller Time", and also on the network's Hannity & Colmes in the division named "Real Free Speech".

Biography of Dennis Miller

Dennis Miller Early life

Dennis Miller developed in Castle Shannon, a colony of Pittsburgh, where Dennis Miller graduated from the Keystone Oaks High School in 1971. And Dennis Miller parents divided and Dennis Miller was raised through his mother, Norma, a dietitian. Dennis Miller is of the Scottish descent. And at the Point Park University, Miller majored in the journalism because Miller supposed it probable simple: "I remember seeing All the President's Men and thinking Redford looked cool in his crinkled tie". Dennis Miller was an associate of the Sigma Tau Gamma organization. Throughout this period, Dennis Miller writes: "When I went to college, I lived on campus, and the guys I hung out with made me do some things I'm not proud of, although they made the characters in Revenge of the Nerds look like the Rat Pack in 1962. I myself made that kid Booger look like Remington Steele" (I Rant, Therefore I Am).

Dennis Miller Career graph

Television career

In early 1980s, Dennis Miller hosted 'The Trolley Show', Saturday daylight newsmagazine for youngsters, on the Pittsburgh's KDKA-TV. Dennis Miller also produced comic dramas for syndicated Evening Magazine TV program. Then Dennis Miller started performing comic role in New York humor union such as The Comic Strip and Catch A Rising Star, with in Los Angeles at The Comedy Store.

Saturday Night Live

Dennis Miller big smash came in the year of 1985, when Dennis Miller was discovered through Lorne Michaels at the Comedy Amass. Dennis Miller landed a blemish on the Saturday Night Live, where Dennis Miller succeeded the Christopher Guest as the Weekend Update commentator.

In the year of 1988, Dennis Miller released a comic CD, The Off-White Album, which is based on the HBO special named Mr. Miller Goes To Washington. Although Dennis Miller passed his spare time on the SNL after the Weekend Update counter, Miller was integrated in some drafts. Dennis Miller did some chronic characters and also icon imitations.

Recurring Characters
  • Koko, one of the fairies in the chronic sketch, Miss Connie's Fable Nook
  • Steve, one of The Stand-Ups (others comprise Jon Levitz as Bob, Damon Wayans as Keith, and also Tom Hanks as Paul)
Celebrity imitation
  • Gary Hart
  • George Harrison

The Dennis Miller Show

In the year of 1992, pursuing his different approach from the Saturday Night Live, Dennis Miller launched late night television chat show, The Dennis Miller Show, associated by Tribune Entertainment. The show team boasted an authentic who’s who of earlier period and potential performers, producers and writers of note comprised Mark Brazil ("That 70's Show"), Todd Baker, David Kohan & Max Mutchnick (creators of "Will & Grace"), Bob Odenkirk ("Mr. Show"), Todd Baker, John Riggi, Herbert Sergeant (Saturday Night Live), Eddie Feldman, Dave Thomas (Second City TV), Drake Sather, and Nick Bakay.

The Dennis Miller Show had limited viewers owing to Tribune's toning it for the time gap in tiny hours of morning. On account of poor ratings, that show was postponed.

Guest Appearances and Commercials

Dennis Miller has emerged as the visitor star on diverse shows, comprised Hannity & Colmes, The Norm Show, The O'Reilly Factor, The Daily Show, News Radio, Sports Center, Real Time with Bill Maher, Boston Public, and also late-night converse shows such as Late Night with David Letterman and The Tonight Show with Jay Leno.

Dennis Miller hosted MTV Video Music Awards in 1995-1996. Miller was the anchor of the HBO's 1996 series of election specials, Not Necessarily the Election.

Dennis Miller has emerged in diverse commercials, providing as an orator for the 10-10-220 long distance service, M&M's candies, and also Internet service supplier Net Zero. And about these actions Dennis Miller has commented: “Everybody has to sell out at some point to make a living. I'm a family man. I sold out to make an M&M commercial. They offer incredible amounts of money, and I say, ‘What can I do to sell one more piece of candy for you? Do you want me to hug the M&M?’ ”

Dennis Miller Private Life

Dennis Miller wedded with Carolyn Epsley, a previous replica from the Vancouver, British Columbia, Canada, in 1988. And Epsley is famous as the girl in Kajagoogoo's "Too Shy" melody video. They have two sons, Marlon and Holden.

In his history fumes about religion, Dennis Miller affirmed "I consider myself to be a Christian." while Miller has altered his views and commented, Dennis Miller is "not a Christian". However, Dennis Miller has affirmed "there is some Christian in me" on his radio program.

Dennis Miller Personal Quote

“I'm a comedian, for God's sake. Viewers shouldn't trust me. And you know what? They're hip enough to know they shouldn't trust me. I'm just doing stand-up comedy.”

Dennis Miller: Media

Dennis Miller - HBO specials
  • Mr. Miller Goes to Washington (1988)
  • The 13th Annual Young Comedians Special (1989) (host)
  • Black and White (1990)
  • Live from Washington, D.C.: They Shoot HBO Specials, Don't They? (1993)
  • State of the Union Undressed (1995)
  • Citizen Arcane (1996)
  • The Millennium Special: 1,000 Years, 100 Laughs, 10 Really Good Ones (1999)
  • The Raw Feed (2003)
  • All In (2006)
Dennis Miller - Audio
  • The Off-White Album (Warner Bros. Records, 1988)
  • The Rants (Random House Audio, 1996)
  • Ranting Again (Random House Audio, 1998)
  • Rants Redux (Random House Audio, 1999)
  • I Rant, Therefore I Am (Random House Audio, 2000)
  • The Rant Zone: An All-Out Blitz Against Soul-Sucking Jobs, Twisted Child Stars, Holistic Loons, and People Who Eat Their Dogs! (HarperAudio, 2001)
  • Still Ranting After All These Years (HarperAudio, 2004)
Dennis Miller - Print
  • The Rants (Doubleday, 1996) ISBN 0-385-47804-6
  • Ranting Again (Doubleday, 1999) ISBN 0-385-48852-1
  • I Rant, Therefore I Am (Doubleday, 2000) ISBN 0-385-49535-8
  • The Rant Zone: An All-Out Blitz Against Soul-Sucking Jobs, Twisted Child Stars, Holistic Loons, and People Who Eat Their Dogs! (HarperCollins, 2001) ISBN 0-06-621066-6